KEGG   Bacillus subtilis subsp. subtilis 168: BSU26430
Entry
BSU26430          CDS       T00010                                 

Symbol
yrkP
Name
(RefSeq) transcriptional regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU26430 (yrkP)
Two-component system [BR:bsu02022]
 OmpR family
  Unclassified
   BSU26430 (yrkP)
SSDB
Motif
Pfam: Response_reg Trans_reg_C HTH_11 HTH_20 HHV6-IE End_N_terminal
Other DBs
NCBI-GeneID: 937663
NCBI-ProteinID: NP_390520
Pasteur: BG11782
BSORF: BG11782
UniProt: P54443 A0A6M3ZJC9
Position
complement(2704435..2705130)
AA seq 231 aa
MAYRILVVEDDEDIGDLLEESLTRAGYEVLRAKDGKRALQLVNDSLDLVILDIMMPGISG
IETCQHIRKSSNVPILFLTARSSTLDKTEGLLAGGDDYMTKPFSEEELHARVIAQLRRYT
IYQEKKEQEETFLIGGKLRVSEEFNEVWKEEKQIKLSDLEYRILKLLMNKRNKIFSAQNI
YESVWGQPYFYCSNNTVMVHIRKLRSKIEDDPARPVYIKTEWGRGYRFGAS
NT seq 696 nt   +upstreamnt  +downstreamnt
atggcctatcgaatattagtcgtagaggatgatgaggatattggtgatcttttggaggaa
tcccttacacgtgcaggttacgaggtgctaagagccaaggatggaaagcgagcattgcaa
cttgtgaatgactcgcttgatttggttattttggatattatgatgccaggcatttcggga
attgaaacatgtcagcacatcaggaaatcctctaacgtcccgattctgtttctgacggcc
agatcgagtacactcgataaaactgagggattactcgccggcggcgatgattatatgact
aaaccattctcggaagaggaacttcacgctagagtgattgctcaattacgcagatatact
atctatcaggaaaagaaggaacaggaagaaacatttcttatcgggggcaaactaagagtg
agcgaagaatttaatgaggtgtggaaagaggagaagcaaatcaagttgtcagatctggag
tatcgtatcctgaaacttctgatgaacaaacgcaacaaaatattttctgcccaaaatata
tatgagagtgtgtggggacagccttacttttactgttccaacaatacggtgatggtgcat
atacggaagctgcgctccaaaattgaggatgatccggcacgtccggtttatataaaaact
gaatggggaagaggatatcgatttggcgcatcttaa

DBGET integrated database retrieval system