KEGG   Bacillus subtilis subsp. subtilis 168: BSU26690
Entry
BSU26690          CDS       T00010                                 
Symbol
brnQ
Name
(RefSeq) branched-chain amino acid transport system carrier protein BrnQ
  KO
K03311  branched-chain amino acid:cation transporter, LIVCS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU26690 (brnQ)
SSDB
Motif
Pfam: Branch_AA_trans ASFV_L11L
Other DBs
NCBI-GeneID: 936930
NCBI-ProteinID: NP_390546
Pasteur: BG11918
BSORF: BG11918
UniProt: P94499 A0A6M3ZE94
Position
complement(2727160..2728482)
AA seq 440 aa
MSKKVSASYIIIIGLMLFALFFGAGNLIFPPMLGQLAGKNVWVANAGFLVTGVGLPLLAI
TAFVFSGKQNLQSLASRVHPVFGIVFTTILYLAIGPFFAIPRSGNVSFEIGVKPFLSNDA
SPVSLIIFTILFFALACLLSLNPSKIIDIVGKFLTPIKLTFIGLLVAVALIRPIGTIQAP
SKGYTSQAFFKGFQEGYLTLDALVAFVFGIIIVNALKEQGASTKKQLIVVCAKAAAIAAV
LLAVMYTALSYMGASSVEELGILENGAEVLAKVSSYYFGSYGSILLGLMITVACLTTSVG
LITACSSFFHELFPNISYKKIAVVLSVFSTLVANIGLTQLIKVSMPVLLTMYPIAISLIF
LTFLHSVFKGKTEVYQGSLLFAFIISLFDGLKAAGIKIEVVNRIFTQILPMYNIGLGWLI
PAIAGGICGYILSIFRTKTS
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgtcaaaaaaagtgtctgcttcctatatcatcattataggattaatgctatttgcattg
ttttttggagcaggaaatctcatttttccgcctatgcttggtcaattggccgggaaaaat
gtatgggtcgctaatgcaggtttcttagtgaccggagttggattgccattactggctata
acagcatttgttttttcgggtaaacaaaacttacagtcgttagccagccgtgttcacccg
gtgtttggcattgtatttacgacgattctctatttggcaatcgggccttttttcgctatc
ccgagatcaggaaacgtatcgtttgaaattggggtaaaaccttttttatcaaatgatgca
agccctgtctcattgatcatatttacaatattatttttcgcattggcatgcttgttatca
ctcaatccttcaaaaatcattgatatagttggtaaatttttgacgccaattaagctgaca
tttatcggattgcttgtagccgtagctcttattcgcccaattggaaccattcaagcacca
tcaaaagggtacacatcacaagcgttttttaaaggatttcaggaaggatacctcactctg
gatgcccttgtagcatttgtttttggaattatcatcgtgaatgcattgaaagaacaagga
gcttctaccaaaaaacagctgatagttgtttgtgcaaaagcagccgcgattgcagctgta
ctcttagcagttatgtatacagccctttcctatatgggggcttccagcgttgaagaactg
gggattttagaaaatggagcagaggttttggctaaggtttcatcctattattttggatct
tatggttcaatcttattgggcttaatgattacagtggcgtgtctgacgacaagtgtcggg
ctgatcacagcgtgttcttcattttttcatgaattatttccgaacatttcttataaaaaa
attgctgtcgttttatcagtgtttagtacgcttgtcgcaaatataggattaacccagctc
attaaggtgtcaatgcctgtcttactgacgatgtatcctatcgcgatttccttaatattt
ttaacgtttttgcattctgtatttaaagggaagacagaagtgtatcaaggcagtttatta
ttcgcattcatcatcagcctatttgacggtttgaaggcggctggaataaaaattgaagtt
gtgaatcgtattttcactcagattcttcctatgtataacatagggctggggtggctcatt
ccagctattgcaggaggaatatgcggctatatactgagtatattccgaacaaaaacaagt
tga

DBGET integrated database retrieval system