KEGG   Bacillus subtilis subsp. subtilis 168: BSU26840Help
Entry
BSU26840          CDS       T00010                                 

Gene name
sigZ
Definition
(RefSeq) RNA polymerase sigma factor SigZ
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU26840 (sigZ)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU26840 (sigZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r2 Sigma70_r4 Sigma70_ECF HTH_24 DUF134 HTH_3 HTH_28 HTH_AsnC-type HTH_23
Motif
Other DBs
NCBI-GeneID: 937617
NCBI-ProteinID: NP_390561
Pasteur: BG11976
BSORF: BG11976
UniProt: O05409
Position
complement(2742244..2742774)
Genome map
AA seq 176 aa AA seqDB search
MNIEDLWDQFHQPLKTYISHRVNDQSIVDDLLQIVFMKIQVHLPNLIDEQKIDSWIYRIT
RNTIIDFYRTKKTSEILPDVLHFNDSAEEENFTKEATVCIRSTIKRLPEKYREALELTDF
QGLSQKELSEKLGISYSGAKSRVQRGRGKLKQLLEGCCHIEADRYGNIVDFRILKE
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagaggatctatgggatcaatttcatcagccgttaaaaacatatatttcacat
agggttaacgatcaatctatcgttgatgacctcttgcaaatcgtatttatgaaaatacaa
gtgcatctcccaaatctgatcgatgaacaaaagatcgacagctggatttatcggatcact
agaaatacgattattgatttttaccgtacaaaaaaaacaagcgaaatattgcctgatgtt
ctacattttaatgacagtgcagaggaagaaaatttcaccaaggaagcaactgtgtgtatt
cgatcgaccatcaaacggttgcctgaaaagtatcgagaggcgctcgagttaactgatttc
caggggttatcacaaaaagagttgagtgaaaagctcggcatttcttactccggagcaaaa
tcaagggtacaacgcggacgtggaaaattaaaacagctgcttgaggggtgctgtcacatt
gaagcggatcgatatggaaatatcgtagactttcgtattttaaaggaataa

DBGET integrated database retrieval system