KEGG   Bacillus subtilis subsp. subtilis 168: BSU27430
Entry
BSU27430          CDS       T00010                                 

Symbol
glnQ
Name
(RefSeq) glutamine transport ATP-binding protein GlnQ
  KO
K10041  aspartate/glutamate/glutamine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU27430 (glnQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27430 (glnQ)
Enzymes [BR:bsu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     BSU27430 (glnQ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Aspartate/glutamate/glutamine transporter
    BSU27430 (glnQ)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 ABC_ATPase AAA_13 AAA_22 AAA_16 AAA_15 RsgA_GTPase ATPase_2 TK AAA_30 AAA_18 AAA_14 Sigma54_activat AAA_33 Rad17 AAA SbcCD_C AAA_27 AAA_19 AAA_28 AAA_5 Adeno_IVa2 NACHT T2SSE RNA12 AAA_24 AAA_25 NB-ARC cobW Zeta_toxin PhoH MMR_HSR1 ATP_bind_1 Pox_ATPase-GT ATP-synt_ab TsaE G-alpha Viral_helicase1 Mg_chelatase
Other DBs
NCBI-GeneID: 937558
NCBI-ProteinID: NP_390620
Pasteur: BG11485
BSORF: BG11485
UniProt: O34677 A0A6M4JLG5
Position
2802358..2803086
AA seq 242 aa
MITFQNVNKHYGDFHVLKQINLQIEKGEVVVIIGPSGSGKSTLLRCINRLESINEGVLTV
NGTAINDRKTDINQVRQNIGMVFQHFHLYPHKTVLQNIMLAPVKVLRQSPEQAKETARYY
LEKVGIPDKADAYPSQLSGGQQQRVAIARGLAMKPEVMLFDEPTSALDPEMIGEVLDVMK
TLAKEGMTMVVVTHEMGFAKEVADRIVFIDEGKILEEAVPAEFYANPKEERARLFLSRIL
NH
NT seq 729 nt   +upstreamnt  +downstreamnt
atgatcacatttcaaaatgtaaacaagcattacggagattttcacgtgttaaaacaaatt
aatcttcaaatcgaaaaaggtgaagtcgttgttatcatcggcccatccggttccggtaaa
agcacattgctcagatgcatcaacagacttgagtcgatcaatgagggagtgcttacagta
aacggcaccgccattaacgacagaaaaactgatatcaatcaagtgcggcaaaatatcggg
atggtgtttcagcactttcatttatatccgcataaaacagtgctgcagaacatcatgctg
gctccggtaaaagtgcttagacaatcacctgaacaagcaaaggaaacggcgcggtactat
cttgaaaaagtcggcatcccagacaaggctgacgcctatccttcccagctttccggcggg
cagcagcagcgtgttgccatcgcaagaggactggcgatgaagccggaggtcatgctgttt
gacgagccgacatcagcacttgatcctgaaatgatcggtgaggtgctagatgtcatgaaa
acactcgccaaagaaggcatgacaatggttgtcgtgacacacgaaatggggtttgccaaa
gaagttgccgaccggattgtcttcattgacgaaggaaaaattttagaagaagcagtgccg
gctgaattttacgcgaacccgaaggaagaacgggcccgcttattcttaagccgtatttta
aatcattaa

DBGET integrated database retrieval system