KEGG   Bacillus subtilis subsp. subtilis 168: BSU27430Help
Entry
BSU27430          CDS       T00010                                 

Gene name
glnQ
Definition
(RefSeq) glutamine transport ATP-binding protein GlnQ
  KO
K10041  aspartate/glutamate/glutamine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00228  Aspartate/glutamate/glutamine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU27430 (glnQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27430 (glnQ)
Enzymes [BR:bsu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     BSU27430 (glnQ)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Aspartate/glutamate/glutamine transporter [MD:M00228]
    BSU27430 (glnQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_29 ABC_ATPase AAA_22 AAA_16 AAA_15 AAA_13 RsgA_GTPase ATPase_2 TK AAA_30 AAA_18 AAA_14 T2SSE Sigma54_activat Rad17 AAA AAA_33 SbcCD_C AAA_27 AAA_5 AAA_28 Adeno_IVa2 NACHT AAA_24 AAA_25 AAA_19 RNA12 IstB_IS21 NB-ARC cobW MMR_HSR1 ATP_bind_1 Pox_ATPase-GT ATP-synt_ab AAA_7 G-alpha Viral_helicase1
Motif
Other DBs
NCBI-GeneID: 937558
NCBI-ProteinID: NP_390620
Pasteur: BG11485
BSORF: BG11485
UniProt: O34677
Position
2802358..2803086
Genome map
AA seq 242 aa AA seqDB search
MITFQNVNKHYGDFHVLKQINLQIEKGEVVVIIGPSGSGKSTLLRCINRLESINEGVLTV
NGTAINDRKTDINQVRQNIGMVFQHFHLYPHKTVLQNIMLAPVKVLRQSPEQAKETARYY
LEKVGIPDKADAYPSQLSGGQQQRVAIARGLAMKPEVMLFDEPTSALDPEMIGEVLDVMK
TLAKEGMTMVVVTHEMGFAKEVADRIVFIDEGKILEEAVPAEFYANPKEERARLFLSRIL
NH
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgatcacatttcaaaatgtaaacaagcattacggagattttcacgtgttaaaacaaatt
aatcttcaaatcgaaaaaggtgaagtcgttgttatcatcggcccatccggttccggtaaa
agcacattgctcagatgcatcaacagacttgagtcgatcaatgagggagtgcttacagta
aacggcaccgccattaacgacagaaaaactgatatcaatcaagtgcggcaaaatatcggg
atggtgtttcagcactttcatttatatccgcataaaacagtgctgcagaacatcatgctg
gctccggtaaaagtgcttagacaatcacctgaacaagcaaaggaaacggcgcggtactat
cttgaaaaagtcggcatcccagacaaggctgacgcctatccttcccagctttccggcggg
cagcagcagcgtgttgccatcgcaagaggactggcgatgaagccggaggtcatgctgttt
gacgagccgacatcagcacttgatcctgaaatgatcggtgaggtgctagatgtcatgaaa
acactcgccaaagaaggcatgacaatggttgtcgtgacacacgaaatggggtttgccaaa
gaagttgccgaccggattgtcttcattgacgaaggaaaaattttagaagaagcagtgccg
gctgaattttacgcgaacccgaaggaagaacgggcccgcttattcttaagccgtatttta
aatcattaa

DBGET integrated database retrieval system