KEGG   Bacillus subtilis subsp. subtilis 168: BSU27469
Entry
BSU27469          CDS       T00010                                 

Symbol
yrzR
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: zf-RRPl_C4 zf-PARP RPA_interact_C zinc_ribbon_15
Other DBs
NCBI-GeneID: 8302944
NCBI-ProteinID: YP_003097767
UniProt: C0H462 A0A6M3ZEM7
Position
complement(2805501..2805692)
AA seq 63 aa
MLICPNCKSKDIGKIGVNQYYCWGCFIELTVAKGKIATHQVEEDGTLSSLDDLFSEDERS
INF
NT seq 192 nt   +upstreamnt  +downstreamnt
atgcttatatgcccgaattgcaaaagtaaggatatcggcaaaatcggcgtgaaccaatat
tattgctggggctgttttattgaactgacagtggcgaaagggaagattgcaactcatcag
gtggaagaagacggaacgttaagcagcttggatgatttgttttctgaggatgaacgcagc
atcaatttttaa

DBGET integrated database retrieval system