KEGG   Bacillus subtilis subsp. subtilis 168: BSU27469Help
Entry
BSU27469          CDS       T00010                                 

Gene name
yrzR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-RRPl_C4 RPA_interact_C zinc_ribbon_15 zf-PARP
Motif
Other DBs
NCBI-GeneID: 8302944
NCBI-ProteinID: YP_003097767
UniProt: C0H462
Position
complement(2805501..2805692)
Genome map
AA seq 63 aa AA seqDB search
MLICPNCKSKDIGKIGVNQYYCWGCFIELTVAKGKIATHQVEEDGTLSSLDDLFSEDERS
INF
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgcttatatgcccgaattgcaaaagtaaggatatcggcaaaatcggcgtgaaccaatat
tattgctggggctgttttattgaactgacagtggcgaaagggaagattgcaactcatcag
gtggaagaagacggaacgttaagcagcttggatgatttgttttctgaggatgaacgcagc
atcaatttttaa

DBGET integrated database retrieval system