KEGG   Bacillus subtilis subsp. subtilis 168: BSU27530Help
Entry
BSU27530          CDS       T00010                                 

Gene name
yrvN
Definition
(RefSeq) ATPase
  KO
K07478  putative ATPase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BSU27530 (yrvN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgsA_C AAA_assoc_2 RuvB_N AAA AAA_16 AAA_14 Sigma54_activat AAA_5 DNA_pol3_delta2 TIP49 AAA_22 Mg_chelatase IstB_IS21 Sigma54_activ_2 AAA_24 NB-ARC RNA_helicase AAA_25 AAA_18 ABC_tran
Motif
Other DBs
NCBI-GeneID: 937545
NCBI-ProteinID: NP_390631
Pasteur: BG13808
BSORF: BG13808
UniProt: O34528
Position
2812336..2813601
Genome map
AA seq 421 aa AA seqDB search
MKPLAYRMRPTKIEDIIGQQHLVAEDKIIGRMVQAKHLSSMILYGPPGIGKTSIATAIAG
STSIAFRKLNAVINNKKDMEIVAQEAKMSGQVILILDEVHRLDKGKQDFLLPYLENGMII
LIGATTANPYHAINPAIRSRTQIFELEPLTPELIKQALERALHDEHRGLGTYSVSIDDQA
MEHFAHGCGGDVRSALNALELAVLSTKESADGEIHITLETAEECLQKKSFSHDKDGDAHY
DVLSAFQKSIRGSDANAALHYLARLIEAGDLESIARRLLVIAYEDIGLASPQAGPRVLNA
IQTAERVGFPEARIPLANAVIELCLSPKSNSAILAIDEALADIRAGKIGDVPKHLKDAHY
KGAQELGRGIDYKYPHNYDNGWVEQQYLPDPLKNKQYYKPKQTGKFESALKQVYDKLMKR
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagccattggcatatcggatgcgtccgacaaaaatagaggatattatcggccagcag
catctggtggctgaagataaaattattggcagaatggtccaggcaaaacatttgtcatcc
atgattttgtacgggccgcccggaattggaaaaacatcaatcgcaacagcaatcgccggt
tcaacaagtattgcttttcgaaagctgaatgctgtcattaacaataaaaaagatatggaa
atcgtagctcaggaagccaagatgtccggccaagtgattttgattctggatgaagtccac
aggctggataaaggaaaacaggattttctattaccctatttagaaaacggaatgatcatt
ttgatcggagcaacgacggctaacccgtatcatgccattaatccggcgatcagaagccgg
acccagatttttgagcttgaaccgttaacacctgaactgattaaacaggcactggaacgt
gcgctccatgatgagcatcggggccttggcacctattctgtatccattgatgatcaggcg
atggagcattttgcccacggatgcggaggagatgtccgctccgctttaaatgcgcttgag
cttgccgtgttgtcaacgaaggagtcagcagacggtgaaattcacattacattagaaacc
gcggaagaatgcttgcagaaaaaaagcttttctcacgataaagatggtgacgcgcattat
gatgtactgtccgcttttcaaaaatcaatccgcggctctgatgccaacgctgctcttcac
tatttggctagattaattgaagccggtgatctggagagcatcgcaagacgattgcttgtt
atcgcctatgaggatatcggtttagcaagcccgcaagccggccctagagtgctgaacgct
attcagaccgctgagcgagtcgggtttcctgaagcgcgaatcccgctggccaacgcagtt
attgagctttgcctctcaccgaaatcaaactctgccattctggcaatcgatgaggccctg
gcagatatcagagccggaaaaattggggatgtcccgaagcatttaaaagacgcgcattat
aaaggagctcaggaattaggaagaggaatcgactataaatacccgcacaattacgacaac
ggttgggtcgaacaacaatacctccctgatcctctgaaaaataagcaatactataagccg
aaacagactggaaagttcgaatctgccttaaagcaggtgtacgataaattaatgaaaaga
aaataa

DBGET integrated database retrieval system