KEGG   Bacillus subtilis subsp. subtilis 168: BSU27700Help
Entry
BSU27700          CDS       T00010                                 

Gene name
yajC
Definition
(RefSeq) preprotein translocase subunit YajC
  KO
K03210  preprotein translocase subunit YajC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
bsu03060  Protein export
bsu03070  Bacterial secretion system
Module
bsu_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU27700 (yajC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU27700 (yajC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU27700 (yajC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU27700 (yajC)
Secretion system [BR:bsu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   BSU27700 (yajC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Chordopox_G3 Orf78 MS_channel
Motif
Other DBs
NCBI-GeneID: 936257
NCBI-ProteinID: NP_390648
Pasteur: BG13785
BSORF: BG13785
UniProt: O32052
Position
complement(2832424..2832690)
Genome map
AA seq 88 aa AA seqDB search
MTGTLGTLVPIILMFAVLYFLLIRPQQKQQKAVRQMQEELKKGDSVVTIGGLHGTVDSID
ESKVVIKTGDNTRLTFDRRAIREVSAAE
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgactggcactttaggtacattggttcctattattttaatgtttgcggtcctttacttc
ttgctgattcgtcctcagcaaaagcagcaaaaggctgtacgccaaatgcaagaggaactg
aaaaaaggcgattcagtagtgacaatcgggggattgcacggtactgttgactctatcgac
gaaagcaaagtcgtaattaagactggtgataacacacgtcttacgttcgaccgccgcgcg
atcagagaagtttctgctgctgaataa

DBGET integrated database retrieval system