KEGG   Bacillus subtilis subsp. subtilis 168: BSU27990Help
Entry
BSU27990          CDS       T00010                                 

Gene name
minD
Definition
(RefSeq) septum site-determining protein MinD
  KO
K03609  septum site-determining protein MinD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU27990 (minD)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bsu04812]
    BSU27990 (minD)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    BSU27990 (minD)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   BSU27990 (minD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiA AAA_31 ParA CBP_BcsQ MipZ Fer4_NifH ArsA_ATPase AAA_24 SRP54 AAA_25 VirC1 CLP1_P AAA_33 MeaB
Motif
Other DBs
NCBI-GeneID: 937499
NCBI-ProteinID: NP_390677
Pasteur: BG10330
BSORF: BG10330
UniProt: Q01464
Position
complement(2857776..2858582)
Genome map
AA seq 268 aa AA seqDB search
MGEAIVITSGKGGVGKTTTSANLGTALAILGKRVCLVDTDIGLRNLDVVMGLENRIIYDL
VDVVEGRCKMHQALVKDKRFDDLLYLMPAAQTSDKTAVAPEQIKNMVQELKQEFDYVIID
CPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQEENIEPPRLVVNRIRNHL
MKNGDTMDIDEIVQHLSIDLLGIVADDDEVIKASNHGEPIAMDPKNRASIAYRNIARRIL
GESVPLQVLEEQNKGMMAKIKSFFGVRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgaggctatcgtaataacttcgggaaaaggcggagtaggtaagacaacaacatct
gcgaacctcggtaccgccttagccattttagggaagcgcgtatgcttagtagatactgat
ataggactgcgcaaccttgatgttgtaatgggtcttgaaaatagaattatttacgatctg
gtagacgttgtagagggcagatgcaaaatgcatcaggcgctcgtaaaagacaaacgtttc
gatgatctgctctatttaatgcccgctgctcaaacgagcgataagacagctgttgctcct
gaacaaattaaaaacatggtccaagagctcaaacaggaatttgactatgtcatcatagac
tgtcctgccggaatcgagcaagggtacaaaaatgccgtttccggagctgataaagcgatt
gtggtcactacgcctgaaatctcagctgttcgtgatgctgaccgtattataggactgctg
gagcaagaggaaaatattgaaccgccgcggctcgttgttaacagaatcagaaatcacctg
atgaaaaacggtgacacgatggatatcgacgaaatcgtacagcatctgtcgatcgatttg
ctcggaatcgtggctgatgatgatgaagtcattaaagcttccaatcatggcgaaccgatt
gcgatggaccctaaaaaccgcgcttccattgcatatcgcaatattgcccgccgcatctta
ggtgaatctgttcctttacaggtgcttgaagagcaaaacaaaggaatgatggctaagatt
aagtcatttttcggagtaagatcttaa

DBGET integrated database retrieval system