KEGG   Bacillus subtilis subsp. subtilis 168: BSU28020Help
Entry
BSU28020          CDS       T00010                                 

Gene name
mreC
Definition
(RefSeq) cell shape-determining protein MreC
  KO
K03570  rod shape-determining protein MreC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU28020 (mreC)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU28020 (mreC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreC bZIP_1 UPF0242 DUF2951
Motif
Other DBs
NCBI-GeneID: 937498
NCBI-ProteinID: NP_390680
Pasteur: BG10327
BSORF: BG10327
UniProt: Q01466
Position
complement(2859832..2860704)
Genome map
AA seq 290 aa AA seqDB search
MPNKRLMLLLLCIIILVAMIGFSLKGGRNTTWPEKVIGDTTGVFQNIFHTPAEFFAGIFE
NINDLKNTYKENERLREKLDGQTQYEAKLQELEEENKSLRDELGHVKSIKDYKPILATVI
ARSPDNWAKQVTINKGTQQNVAKDMAVTNEKGALIGKIKSSGLNNFTSAVQLLSDTDRNN
RVATKISGKKGSKGYGLIEGYDKEKKRLKMTIIERKDKQDVKKGDLIETSGTGGVFPEGL
TIGEVTDIESDSYGLTKVAYVKPAADLTDLNNVIVVNRDVPTVDTEEEGS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgccgaataagcggttaatgctattacttctgtgtattatcatattggtggctatgatt
ggattttcgctgaagggcggccgcaataccacctggcctgagaaagtgatcggcgatacg
acgggagtatttcaaaatatttttcatacgcctgccgaattttttgcaggaatatttgag
aacatcaatgatttaaaaaacacatacaaagaaaacgagcgtctaagagaaaaacttgac
ggacagacacaatatgaagccaagcttcaagagcttgaagaagaaaacaaatccttgcgt
gacgagcttggccatgtcaaatcgattaaagattacaagccgattttagcaacggtcatc
gccagaagccctgataattgggcgaaacaggtcaccattaacaaggggactcagcaaaac
gtagcgaaagatatggccgttacaaacgaaaaaggcgcattaatcggcaagatcaaaagc
tccggacttaacaattttacgtctgctgttcagcttttaagcgatactgaccgcaataac
agagtcgcgacaaaaatttccggaaaaaaaggcagcaaaggctacggcttgatcgaagga
tatgacaaagagaaaaaacgtcttaagatgacaattattgagcgtaaggataaacaagac
gtgaaaaaaggcgatcttattgaaacatcagggacaggcggtgttttcccagaagggctg
acaatcggtgaagtgactgatatcgagtcagattcctatggattaacgaaggttgcttat
gtaaaacctgcggctgaccttacagatttaaataatgtgatcgttgttaaccgtgacgtg
ccgactgtcgatacagaggaggaaggatcgtga

DBGET integrated database retrieval system