KEGG   Bacillus subtilis subsp. subtilis 168: BSU28190Help
Entry
BSU28190          CDS       T00010                                 

Gene name
engB
Definition
(RefSeq) GTP-binding protein EngB
  KO
K03978  GTP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU28190 (engB)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU28190 (engB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMR_HSR1 FeoB_N Dynamin_N AIG1 RsgA_GTPase Septin GTP_EFTU Roc SRPRB AAA_18 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 938009
NCBI-ProteinID: NP_390697
Pasteur: BG10339
BSORF: BG10339
UniProt: P38424
Structure
PDB: 

Position
complement(2879882..2880469)
Genome map
AA seq 195 aa AA seqDB search
MKVTKSEIVISAVKPEQYPEGGLPEIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQ
TLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPS
NDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKVVRQTLNIDPEDELILFSSETKK
GKDEAWGAIKKMINR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcacaaagtcagaaatcgtgatcagtgcagtaaaaccggaacagtaccctgaa
ggggggcttccggaaatcgcattggccggaagatcgaacgtaggaaaatcgtcttttatc
aattcattaatcaatcgcaaaaatcttgcgagaacgtcatcaaagccgggaaaaacacaa
acgcttaatttctacattatcaatgatgagctgcattttgtggatgtgccgggctacggt
tttgccaaagtgtcaaagtctgagcgtgaagcatggggcagaatgattgaaacctatatc
acgacacgcgaggaattaaaagctgtggtgcagatcgttgatttgcggcatgcgccatct
aatgatgatgtacagatgtatgaatttttaaagtattacggcattcctgttattgttatc
gctacaaaggcggataagatcccgaaaggtaaatgggacaaacacgcgaaggttgtccga
caaacattaaatattgatccggaagacgagctgatcctcttttcttcagaaacgaaaaag
ggaaaagacgaagcttggggagcgatcaaaaaaatgataaaccggtag

DBGET integrated database retrieval system