KEGG   Bacillus subtilis subsp. subtilis 168: BSU28200Help
Entry
BSU28200          CDS       T00010                                 

Gene name
lonA
Definition
(RefSeq) Lon protease 1
  KO
K01338  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU28200 (lonA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     BSU28200 (lonA)
Peptidases [BR:bsu01002]
 Serine Peptidases
  Family S16: lon protease family
   BSU28200 (lonA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lon_C LON_substr_bdg AAA AAA_5 ChlI AAA_2 RuvB_N AAA_3 AAA_16 AAA_PrkA AAA_22 RsgA_GTPase AAA_18 NTPase_1 AAA_14 Rad17 RNA_helicase IstB_IS21 NACHT AAA_33 TsaE TIP49 Zeta_toxin NB-ARC AAA_24 Tox-SHH SKI AAA_lid_3 AAA_17
Motif
Other DBs
NCBI-GeneID: 937486
NCBI-ProteinID: NP_390698
Pasteur: BG10338
BSORF: BG10338
UniProt: P37945
Structure
PDB: 

Position
complement(2880466..2882790)
Genome map
AA seq 774 aa AA seqDB search
MAEELKRSIPLLPLRGLLVYPTMVLHLDVGRDKSVQALEQAMMHDHMIFLATQQDISIDE
PGEDEIFTVGTYTKIKQMLKLPNGTIRVLVEGLKRAHIVKYNEHEDYTSVDIQLIHEDDS
KDTEDEALMRTLLDHFDQYIKISKKISAETYAAVTDIEEPGRMADIVASHLPLKLKDKQD
ILETADVKDRLNKVIDFINNEKEVLEIEKKIGQRVKRSMERTQKEYYLREQMKAIQKELG
DKEGKTGEVQTLTEKIEEAGMPDHVKETALKELNRYEKIPSSSAESSVIRNYIDWLVALP
WTDETDDKLDLKEAGRLLDEEHHGLEKVKERILEYLAVQKLTKSLKGPILCLAGPPGVGK
TSLAKSIAKSLGRKFVRISLGGVRDESEIRGHRRTYVGAMPGRIIQGMKKAGKLNPVFLL
DEIDKMSSDFRGDPSSAMLEVLDPEQNSSFSDHYIEETFDLSKVLFIATANNLATIPGPL
RDRMEIINIAGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGV
RSLERQLAAICRKAAKAIVAEERKRITVTEKNLQDFIGKRIFRYGQAETEDQVGVVTGLA
YTTVGGDTLSIEVSLSPGKGKLILTGKLGDVMRESAQAAFSYVRSKTEELGIEPDFHEKY
DIHIHVPEGAVPKDGPSAGITMATALVSALTGRAVSREVGMTGEITLRGRVLPIGGLKEK
ALGAHRAGLTTIIAPKDNEKDIEDIPESVREGLTFILASHLDEVLEHALVGEKK
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaattaaaacgcagcatcccgctcctccctttaagaggtttattagtgtac
ccgacgatggttttgcatttagatgtaggacgtgacaagtcggttcaggctcttgaacag
gcaatgatgcatgatcatatgatatttttagccactcagcaggatatttcgatagacgaa
cctggtgaagacgagattttcactgtcggcacctatacaaaaattaagcaaatgctgaag
cttccgaacggtacgattcgtgtgttggtggagggcctcaagcgcgcccatatcgtcaaa
tacaatgaacacgaggattacacgtcggttgacattcaacttattcatgaagatgattca
aaagatacagaagacgaagcattgatgcggactttgctagaccactttgatcagtacata
aaaatttctaaaaaaatctcggccgaaacgtacgctgcggttactgatatcgaagagccg
gggagaatggcagacatcgttgcttctcatctgccccttaaactaaaggataagcaggat
attttagaaacggctgatgtcaaagacaggctgaacaaggtcattgattttattaataat
gaaaaagaagtgctggagattgagaaaaaaatcggccagcgcgtcaaacgttcgatggag
cgtacgcagaaggaatactacttgcgtgaacaaatgaaggcgatccaaaaagagcttggc
gataaagaaggcaaaactggcgaagttcagacgctgacggaaaaaatcgaagaagcaggc
atgcctgatcatgtgaaagaaacagcgcttaaagaattgaacagatatgaaaaaattccg
tcaagttctgcggaaagctctgtgatccgcaactatatcgactggctggttgctcttccg
tggacggatgaaacagatgataagcttgatttgaaagaagcaggacgtctcttggacgaa
gagcaccacgggcttgaaaaagtaaaagaacgtattttagaatatttggctgtccagaag
ctgacaaaatccctgaaaggcccgattctctgtttggcaggacctccaggtgtcggaaaa
acgtctttagccaaatcaattgcaaaaagcttgggacgcaaattcgtcagaatctcactc
ggaggagttcgggatgaatcagagatacgcggacacagacggacctatgtcggagcaatg
cctggacgtattattcaagggatgaaaaaagcgggcaagctgaatccggtcttcttatta
gacgaaattgacaaaatgtcatctgattttagaggagacccatcatccgctatgcttgaa
gtgcttgatccagagcaaaacagcagcttcagtgatcactatattgaagaaacctttgat
ttatccaaagtgctgtttatcgcaacggcgaacaatttggccacaatcccgggcccgctc
agagacagaatggaaattattaatatcgcaggctacacagaaatagaaaaacttgaaatt
gtaaaggatcacttgcttccaaagcaaatcaaagaacacgggctgaagaaaagcaatctt
cagctgcgtgatcaggcgattcttgatattattcgttactatacgagagaagcgggtgta
agaagccttgaacgccagcttgccgcaatttgccgtaaagctgcaaaagccattgttgct
gaagagcgaaaacgaattacggttactgagaagaaccttcaagattttatcggaaaacgc
attttcagatatggacaagctgaaacagaggatcaagttggtgtagtgacagggcttgcg
tatacaaccgttggcggagatacgctttcgattgaagtatcgctttcaccgggaaaaggg
aaattaatcctgacaggaaagctcggagatgttatgagagagtctgctcaggctgcattc
agctatgtgcgatccaaaacagaagaacttggcattgaacctgactttcatgagaagtat
gatattcatatacatgtaccagagggtgcggtgccaaaagatggtccgtcagccggtatt
acgatggcaacagcgcttgtttctgctttaacgggacgggcggtttcgcgtgaagtcggc
atgactggggaaatcacgcttcgcgggcgcgtgctgccgatcggcggcttaaaggaaaaa
gcgcttggcgcacatagagcgggattaacgaccattattgcgcctaaagataatgaaaaa
gatatagaggatattccggaaagcgtcagggaggggctgacatttatattggcgtcccac
ttagacgaggttttggaacatgccttagtaggagagaagaaatga

DBGET integrated database retrieval system