KEGG   Bacillus subtilis subsp. subtilis 168: BSU28340Help
Entry
BSU28340          CDS       T00010                                 

Gene name
ysnF
Definition
(RefSeq) stress response protein YsnF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2382 YflT
Motif
Other DBs
NCBI-GeneID: 936228
NCBI-ProteinID: NP_390712
Pasteur: BG12337
BSORF: BG12337
UniProt: P94560
Position
2898931..2899752
Genome map
AA seq 273 aa AA seqDB search
MKSIVGVYETPQETIAAIEGLLTKGYDSDDISVVTSRRDTDYLESRTGTEVNQAIDAHQD
ESESFFDKLKDYFTMDDTATHSKALSDLDIKTDEIDKYQEDLDDGKLLVAVDTDADVIAP
IDNGNALSGGFSSTNELDYTTKEEKTMPLREEQLKVDKEDVQTGEVEIGKEVKTEKRDMD
IPVRHDEIYVERRPVDENKTDAAPVNDSEEIRVPIVEEKLEVTKKPVVTDEVVVGKRTVE
ENEHISETVKKEEPRLNKEGKVDGLDDDPLNNK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatagttggtgtatatgaaactccgcaggaaaccatcgcagcgattgaaggc
ttacttacaaaaggctatgattctgatgacatttctgttgtgacaagccggcgagataca
gattatttggagtcacgtacaggaacagaagtcaatcaagctatcgatgcacatcaggac
gaatctgaatcttttttcgataaactgaaagattatttcacaatggatgatactgctaca
cacagcaaagcattatccgacttggatattaaaactgatgaaatagacaagtatcaagaa
gatttggatgacggaaaacttctggtagccgtcgatacagatgcagatgtaattgctcct
attgataacggcaatgccctttcaggcggcttttcaagcacaaatgaattggattataca
acgaaagaagaaaaaacgatgccgctccgggaagaacagctgaaggtcgataaggaagac
gttcaaaccggcgaagtagaaataggaaaagaagtgaaaacagaaaaaagagatatggac
attccggtgagacatgatgaaatttatgtcgaacgccgtccagtggatgaaaataaaacg
gacgctgctcccgtcaacgattcggaagagatcagagttccaatcgttgaggaaaagctg
gaagtgactaaaaaaccggttgtcactgatgaagtggttgtcggcaaacgcactgttgaa
gaaaatgaacatatttctgaaactgtgaaaaaagaagaacctcgtctgaataaagaagga
aaagttgacggcttggatgatgatccgttaaataacaaatga

DBGET integrated database retrieval system