KEGG   Bacillus subtilis subsp. subtilis 168: BSU28490Help
Entry
BSU28490          CDS       T00010                                 

Gene name
uvrC
Definition
(RefSeq) UvrABC system protein C
  KO
K03703  excinuclease ABC subunit C
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU28490 (uvrC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU28490 (uvrC)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU28490 (uvrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrC_HhH_N UVR GIY-YIG HHH_5 HHH_2 5_3_exonuc GlutR_N ADPrib_exo_Tox Mt_ATP-synt_D
Motif
Other DBs
NCBI-GeneID: 937729
NCBI-ProteinID: NP_390727
Pasteur: BG10349
BSORF: BG10349
UniProt: P14951
Position
complement(2911116..2912888)
Genome map
AA seq 590 aa AA seqDB search
MNKQLKEKLALLPDQPGCYLMKDRQQTVIYVGKAKVLKNRVRSYFTGSHDAKTQRLVTEI
EDFEYIVTSSNLEALILEMNLIKKHDPKYNVMLKDDKTYPFIKLTHERHPRLIVTRNVKK
DKGRYFGPYPNVQAARETKKLLDRLYPLRKCSKLPDRVCLYYHLGQCLAPCVKDISEETN
RELVESITRFLRGGYNEVKKELEEKMHEAAENLEFERAKELRDQIAHIESTMEKQKMTMN
DLVDRDVFAYAYDKGWMCVQVFFIRQGKLIERDVSMFPLYQEADEEFLTFIGQFYSKNNH
FLPKEILVPDSIDQSMIEQLLETNVHQPKKGPKKELLMLAHKNAKIALKEKFSLIERDEE
RSIGAVQKLGEALNIYTPHRIEAFDNSNIQGTNPVSAMIVFIDGKPYKKEYRKYKIKTVT
GPDDYGSMREVVRRRYTRVLRENLPLPDLIIIDGGKGQINAARDVIENELGLDIPIAGLA
KDEKHRTSNLLIGDPLEVAYLERNSQEFYLLQRIQDEVHRFAISFHRQIRGKSAFQSVLD
DIPGIGEKRKKMLLKHFGSVKKMKEASLEDIKKAGVPAAAAQLLYDKLQK
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacaactgaaagaaaaactcgccctccttcctgatcaaccgggttgttatctc
atgaaggaccggcagcagactgtgatctacgtagggaaagcaaaagtgctgaaaaacaga
gtgcgctcctacttcaccggttctcacgacgcgaaaacccaaaggcttgtgacggaaatc
gaggattttgaatatattgtgacgtcctccaatcttgaagcgcttattttagaaatgaat
ctgatcaaaaagcatgatccgaaatacaacgtcatgctcaaagacgacaaaacctatcct
ttcataaaactcacccatgaacgccacccaaggctgattgtcacccgcaatgtcaaaaaa
gacaaagggcgctatttcgggccgtatccgaatgtacaggcagcaagggaaacaaaaaaa
ctgctcgaccgtctgtatcctctcagaaaatgctccaagctcccggacagagtgtgcctt
tactatcatctgggccaatgccttgctccgtgtgtaaaggatatttccgaagagacgaac
agagagctggttgaaagcattacacgtttcttaaggggcggctataatgaggtcaaaaaa
gagcttgaagagaaaatgcatgaagctgctgagaatcttgagtttgaacgagcaaaagag
cttcgtgaccaaattgcccatattgaatcaacgatggaaaaacaaaaaatgacgatgaac
gatctagtcgaccgtgatgtgttcgcgtacgcgtacgataagggctggatgtgcgtgcag
gtctttttcatccgccaaggaaagctcattgaacgcgatgtcagcatgttcccgctttat
caggaagcagatgaagagttcctcacgttcatcgggcagttctattcaaaaaacaaccac
ttccttccgaaggagattttagttccggacagcatagatcaatctatgatcgagcagcta
ctggaaacaaacgttcaccagccgaaaaaaggcccgaaaaaagaactgctcatgcttgcc
cataaaaatgcgaaaatcgcattgaaagaaaaattctctttaatcgaacgggacgaggag
cgttcaatcggggcagtgcagaaactaggtgaggcattaaatatttatacgccgcacaga
attgaagcgtttgataactcaaatatacaggggacaaacccggtttccgcgatgattgtg
tttatcgatggcaaaccatacaaaaaggaataccgcaaatataaaatcaaaactgttaca
gggccggatgattacggttctatgagagaggttgtcagaagacgctatacgagagtgctt
cgtgagaatctgccgctgcccgatctgattatcattgacggaggaaaagggcagatcaac
gcagcaagggatgtcattgaaaatgaactcggcttggatatcccgatcgccggtttagcg
aaagatgaaaaacacagaacctcaaatttactgatcggtgatccgctggaggtggcgtat
ctggaacgaaacagccaggaattttacctcctgcagcgcattcaggacgaggtgcaccgt
tttgcaatcagttttcacaggcaaatccggggaaaaagcgcgtttcaatccgttttggac
gacatcccgggtatcggagagaaaagaaagaaaatgctgttaaagcatttcggttccgtt
aaaaaaatgaaggaagcaagccttgaggacatcaaaaaagccggtgttcccgcagcggcg
gctcagctcctttacgacaaattgcaaaaataa

DBGET integrated database retrieval system