KEGG   Bacillus subtilis subsp. subtilis 168: BSU28580Help
Entry
BSU28580          CDS       T00010                                 

Gene name
mutSB
Definition
(RefSeq) methyl-directed mismatch repair protein MutS
  KO
K07456  DNA mismatch repair protein MutS2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    BSU28580 (mutSB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU28580 (mutSB)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     BSU28580 (mutSB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutS_V Smr MutS_III AAA_21 ERM Lebercilin Mitofilin
Motif
Other DBs
NCBI-GeneID: 937447
NCBI-ProteinID: NP_390736
Pasteur: BG12328
BSORF: BG12328
UniProt: P94545
Position
complement(2920936..2923293)
Genome map
AA seq 785 aa AA seqDB search
MQQKVLSALEFHKVKEQVIGHAASSLGKEMLLELKPSASIDEIKKQLDEVDEASDIIRLR
GQAPFGGLVDIRGALRRAEIGSVLSPSEFTEISGLLYAVKQMKHFITQMAEDGVDIPLIH
QHAEQLITLSDLERDINSCIDDHGEVLDHASETLRGIRTQLRTLESRVRDRLESMLRSSS
ASKMLSDTIVTIRNDRFVIPVKQEYRSSYGGIVHDTSSSGATLFIEPQAIVDMNNSLQQA
KVKEKQEIERILRVLTEKTAEYTEELFLDLQVLQTLDFIFAKARYAKAVKATKPIMNDTG
FIRLKKARHPLLPPDQVVANDIELGRDFSTIVITGPNTGGKTVTLKTLGLLTLMAQSGLH
IPADEGSEAAVFEHVFADIGDEQSIEQSLSTFSSHMVNIVGILEQVNENSLVLFDELGAG
TDPQEGAALAMSILDDVHRTNARVLATTHYPELKAYGYNREGVMNASVEFDIETLSPTYK
LLIGVPGRSNAFEISKRLGLPDHIIGQAKSEMTAEHNEVDTMIASLEQSKKRAEEELSET
ESIRKEAEKLHKELQQQIIELNSKKDKMLEEAEQQAAEKVKAAMKEAEDIIHELRTIKEE
HKSFKDHELINAKKRLEGAMPAFEKSKKPEKPKTQKRDFKPGDEVKVLTFGQKGTLLEKT
GGNEWNVQIGILKMKVKEKDLEFIKSAPEPKKEKMITAVKGKDYHVSLELDLRGERYENA
LSRVEKYLDDAVLAGYPRVSIIHGKGTGALRKGVQDLLKNHRSVKSSRFGEAGEGGSGVT
VVELK
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcaaaaagtattatcagctcttgaatttcataaagtgaaagaacaggttattggg
catgccgcttcatcgctcggaaaagaaatgcttctcgagcttaagccttctgcttctata
gacgaaatcaaaaaacagctggatgaagtagacgaagcttctgacattatccggctgaga
ggccaagcgccatttggcggccttgtagatatcagaggagcgttaagacgggcggaaatc
ggcagcgttctcagtccttctgaattcactgaaatctcaggcctgctttatgcagttaaa
caaatgaaacattttatcacgcaaatggctgaagacggtgtcgacattccgctgatccat
cagcatgctgaacagcttatcacgctgtccgatttagagcgggacattaattcctgcatt
gatgatcacggagaagtgcttgatcatgcatcggaaacattaagaggaatccgcacacag
ctcagaacactcgaatcaagagtcagagaccggttagagtcgatgctgcgttcctcttcc
gcatcgaaaatgctgtctgatacgattgttacgattcggaatgaccgctttgtgatcccg
gtcaaacaggagtacagatccagctatggaggaattgtgcacgacacctcatcctctggt
gcgacactattcattgaaccgcaggcgattgtagatatgaacaattcccttcagcaggcg
aaagtgaaagaaaagcaagaaattgaacggattttgcgtgtgctgacagagaaaacggca
gagtatacagaggagctatttctagatttgcaagtgctgcagacgcttgactttattttt
gcaaaagctagatatgcaaaagcggttaaagcgacaaaaccgattatgaacgacaccggc
tttatccgtttgaaaaaagcccgccatccattgcttccgcctgatcaggttgttgccaat
gacatcgagcttggccgcgatttttcaaccattgtcatcacagggccaaacaccgggggg
aaaacagtcacccttaaaacgttaggcctgctaaccttaatggcgcagtcaggtcttcat
atcccggcagatgaagggtcagaagcggcagtatttgagcacgtattcgctgatatcggt
gatgaacagtcgattgagcaaagtttaagtacgttctcatcccatatggtgaatattgtc
ggcattttagaacaggtcaatgaaaacagccttgtgcttttcgatgaacttggtgcaggg
acagatccgcaggagggggcggccctcgccatgagcatcttggatgacgtgcatcgcacc
aatgcacgagtgttagctacgacgcattatccggaattgaaggcgtacggctataacaga
gaaggcgtcatgaatgccagcgttgaatttgacatcgaaacgctgtcaccgacctataaa
cttttaattggtgtgccgggtcgaagcaatgctttcgaaatttcaaaacgcctcgggctc
ccggaccatatcatcgggcaggcgaagtcagaaatgacggccgagcataacgaagtcgat
acgatgattgcgtcgctggaacaaagcaaaaaacgtgcggaagaagagctttctgagaca
gaatcaatcagaaaagaagcggaaaaactgcataaagagctgcagcagcaaatcatcgag
cttaacagcaaaaaagacaaaatgcttgaagaggcagaacagcaggctgctgaaaaagta
aaagcggcaatgaaagaagccgaggacattattcatgaattgcgcaccataaaagaagaa
cacaaatccttcaaggatcacgagctgattaacgcgaagaaacggttagaaggcgctatg
cctgcttttgaaaagtccaagaaaccggaaaagccgaaaacgcaaaaacgcgactttaag
cctggcgacgaggtgaaagtcctcactttcgggcaaaaaggaacattgctcgaaaaaaca
ggcggcaatgaatggaacgttcaaatcggtattttaaagatgaaagtaaaagaaaaagat
ctggagtttatcaaatcagctccggagccaaaaaaagaaaaaatgattacagcggtcaaa
ggaaaggactatcacgtatcgcttgaacttgatcttcgcggcgaacgctatgaaaatgcc
ctcagccgggttgaaaaatacttggatgatgcggtgttagccggatatccaagagtgtca
atcatccacggaaaaggaaccggcgctttaagaaaaggcgtacaggatcttctgaaaaac
caccgcagcgtcaaaagttcccgtttcggtgaagcaggtgagggaggatcaggcgttacg
gttgttgaactaaaataa

DBGET integrated database retrieval system