KEGG   Bacillus subtilis subsp. subtilis 168: BSU28980
Entry
BSU28980          CDS       T00010                                 

Gene name
dnaI
Definition
(RefSeq) primosomal protein DnaI
  KO
K11144  primosomal protein DnaI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU28980 (dnaI)
DNA replication proteins [BR:bsu03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BSU28980 (dnaI)
SSDB
Motif
Pfam: DnaI_N Bac_DnaA IstB_IS21 AFG1_ATPase AAA ATPase_2 KAP_NTPase RNA_helicase ResIII ArsA_ATPase AAA_16 DUF2791 TsaE AAA_22 ATP-synt_ab NACHT AAA_7 AAA_14 PhoH NTPase_1 DUF2406 Protoglobin Vpu CbiA
Other DBs
NCBI-GeneID: 936873
NCBI-ProteinID: NP_390776
Pasteur: BG10359
BSORF: BG10359
UniProt: P06567 A0A6M3ZEU2
Structure
PDB: 
4M4W 2K7R

Position
complement(2963185..2964120)
AA seq 311 aa
MEPIGRSLQGVTGRPDFQKRLEQMKEKVMKDQDVQAFLKENEEVIDQKMIEKSLNKLYEY
IEQSKNCSYCSEDENCNNLLEGYHPKLVVNGRSIDIEYYECPVKRKLDQQKKQQSLMKSM
YIQQDLLGATFQQVDISDPSRLAMFQHVTDFLKSYNETGKGKGLYLYGKFGVGKTFMLAA
IANELAEKEYSSMIVYVPEFVRELKNSLQDQTLEEKLNMVKTTPVLMLDDIGAESMTSWV
RDEVIGTVLQHRMSQQLPTFFSSNFSPDELKHHFTYSQRGEKEEVKAARLMERILYLAAP
IRLDGENRRHP
NT seq 936 nt   +upstreamnt  +downstreamnt
atggaaccaatcggccgttccctgcagggcgtaaccggcaggccggatttccaaaaacgt
cttgaacaaatgaaggaaaaagtcatgaaagatcaagatgttcaagcatttttgaaggaa
aacgaagaagtgattgaccaaaaaatgatcgaaaagagcttaaataagctttatgaatat
atcgaacaaagcaagaattgctcctattgttcggaagatgaaaactgcaacaatttgttg
gagggctaccatccgaagcttgttgtcaatgggaggtctattgatatcgagtattacgaa
tgtccagtcaaacggaagctcgaccagcagaagaaacaacagtctcttatgaaaagcatg
tatatccagcaggatcttcttggagcgacgttccagcaagttgatatcagtgacccaagc
agactcgcgatgtttcagcatgttacagacttcctgaaaagctataatgagacgggaaaa
gggaaaggattatatttatacgggaaatttggggtaggaaaaacgtttatgctcgctgca
attgccaatgagctggcggaaaaagagtattcctccatgattgtttatgtgcctgaattt
gtgagagagcttaagaattcgctgcaagaccagacattggaagagaagctcaatatggta
aagaccacacccgtattaatgcttgatgacatcggagcagaatcaatgacaagctgggta
agggatgaggtcatcggaacggtgcttcagcacagaatgtcccagcagctgccaacgttc
ttttcttctaatttctcacctgacgagctgaagcatcattttacgtattcgcagagggga
gaaaaagaagaagtaaaagctgcaagattaatggagcggatattatatttggctgctccg
atccgccttgacggagaaaaccgccgacatccataa

DBGET integrated database retrieval system