KEGG   Bacillus subtilis subsp. subtilis 168: BSU29740
Entry
BSU29740          CDS       T00010                                 

Symbol
ccpA
Name
(RefSeq) catabolite control protein A
  KO
K02529  LacI family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU29740 (ccpA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    BSU29740 (ccpA)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_3 HTH_26 HTH_31 HTH_7
Other DBs
NCBI-GeneID: 935942
NCBI-ProteinID: NP_390852
Pasteur: BG10376
BSORF: BG10376
UniProt: P25144 A0A6M4JKW9
Structure
PDB: 
2FEP 3OQM 3OQO 3OQN

Position
complement(3044165..3045169)
AA seq 334 aa
MSNITIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPNAVARGLASKK
TTTVGVIIPDISSIFYSELARGIEDIATMYKYNIILSNSDQNMEKELHLLNTMLGKQVDG
IVFMGGNITDEHVAEFKRSPVPIVLAASVEEQEETPSVAIDYEQAIYDAVKLLVDKGHTD
IAFVSGPMAEPINRSKKLQGYKRALEEANLPFNEQFVAEGDYTYDSGLEALQHLMSLDKK
PTAILSATDEMALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGA
VAMRLLTKLMNKEPVEEHIVELPHRIELRKSTKS
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgagcaatattacgatctacgatgtagcgagagaagctaatgtaagcatggcaaccgtt
tcccgtgtcgtgaacggcaacccgaatgtaaaaccgacaacgaggaaaaaagtcttggaa
gccattgaacgtctcggttaccgtccaaacgcggtggcaagagggctggcaagtaaaaaa
acaacaactgtaggtgtcatcattcccgatatctcaagcattttctattcagagcttgcg
cgcggaattgaagatatcgcgacaatgtataaatacaatattattttgagcaactctgac
caaaacatggagaaagagctgcacttgttaaacacaatgctcggcaaacaagtggacggc
atcgtgtttatgggcggaaacattacggacgagcatgtggcggaatttaagcgttctcca
gtgccgattgtacttgccgcttctgtagaagagcaggaggaaacaccgtcagtcgctatc
gattacgaacaggcgatttatgatgccgtgaagcttttggttgataaaggacatacagac
atcgcgttcgtttccggaccaatggcagaaccgatcaaccgttcgaaaaaactccaaggc
tacaaacgtgcgcttgaagaagcgaaccttccgtttaatgaacaatttgtagctgaaggg
gattacacatatgattccggactcgaagcactgcagcatctgatgagcctggataaaaaa
ccgacagccattctttctgcaactgatgaaatggcactcggcattatccatgccgctcag
gatcagggcttatccattccggaggatctcgacattatcggttttgataatacaagatta
agcctcatggttcgtcctcagctttcaacagttgttcagccgacatatgatatcggcgcc
gttgcgatgagactgctgacgaagctcatgaataaagagccggttgaagagcatatcgtc
gaactgccgcaccgtatagagcttagaaagtcaaccaagtcataa

DBGET integrated database retrieval system