KEGG   Bacillus subtilis subsp. subtilis 168: BSU29850
Entry
BSU29850          CDS       T00010                                 

Symbol
ytoQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Nuc_deoxyri_tr3 Nuc_deoxyri_tr2 Nuc_deoxyrib_tr LDcluster4 TIR_2 IR1-M HTH_24 HTH_11 Phage_int_SAM_4
Other DBs
NCBI-GeneID: 937302
NCBI-ProteinID: NP_390863
Pasteur: BG13899
BSORF: BG13899
UniProt: O34305 A0A6M4JNY2
Position
3054746..3055192
AA seq 148 aa
MEFIVYLAGEIHSNWREEIKEKTKSLKLPITFVGPMENHDRSDNIGEEIMGVQPNAVLKD
DKASDINNFRTAVLMNKADFVIALFGEKYKQWNTAMDASYAIAKGKPLIIIRPESLHHPL
KELSNKANITVETVNQAIKALSYLFETE
NT seq 447 nt   +upstreamnt  +downstreamnt
atggagtttatcgtctatttagcaggagaaatccacagcaattggcgcgaggaaattaaa
gaaaaaacaaaatcactgaagctcccgattacgtttgttggcccgatggagaatcatgac
cgctcagacaatattggtgaagaaattatgggcgtacagccaaatgccgttttaaaggat
gacaaagcctctgacatcaacaacttcagaaccgccgtcctgatgaataaagcagacttt
gtgatcgccctgtttggcgaaaagtacaaacagtggaacacggcaatggatgcatcatat
gcgatcgcaaaaggaaaacccctgattatcatccggccggaatcgctccaccatccttta
aaagagctttccaataaagcgaatattacggttgaaaccgttaaccaagccattaaggcc
ctttcctatctatttgaaacagaataa

DBGET integrated database retrieval system