KEGG   Bacillus subtilis subsp. subtilis 168: BSU30110
Entry
BSU30110          CDS       T00010                                 

Symbol
yteS
Name
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_18 LPAM_1
Other DBs
NCBI-GeneID: 937272
NCBI-ProteinID: NP_390889
Pasteur: BG13844
BSORF: BG13844
UniProt: C0SP80 A0A6M4JMB6
Position
complement(3080631..3081134)
AA seq 167 aa
MTKRIRTALCVIVSVLFLASCSSRPDGMHVILFSDMQAGVQEKIKKAAEQNAGKVDIFPA
FQEKLLTEITAHEGDVFIVPEDMFQAYDDPENFQPLNGLPPEKTSPYTTVNKKTGEKTIY
AVQIEKGKKQLNGYSFQLNRDMAAFIPVYAEKTEEALQLISQLTEAR
NT seq 504 nt   +upstreamnt  +downstreamnt
atgacaaaaaggatacgtacggctttgtgtgtgatcgtctcagtgctctttttggcatca
tgctcaagcaggccggacggaatgcatgtcattctcttttctgatatgcaggctggcgta
caggaaaaaataaaaaaggccgccgagcagaatgccgggaaggtcgatatctttccagct
tttcaggaaaaactgctgactgaaattaccgcccatgagggagatgttttcatcgtgcct
gaagacatgtttcaagcttacgatgatccggaaaattttcagccgttaaacggattgcct
cctgaaaaaacatctccttatacaactgttaataaaaaaacaggagaaaaaacgatctat
gccgttcagatcgaaaaagggaaaaaacagctgaacggctattcttttcaattgaatcgc
gatatggcggcgtttatccctgtgtatgctgaaaaaacagaggaagcgctgcagctgatt
tctcaactaactgaagcccgatag

DBGET integrated database retrieval system