KEGG   Bacillus subtilis subsp. subtilis 168: BSU30150
Entry
BSU30150          CDS       T00010                                 

Symbol
ytdP
Name
(RefSeq) AraC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_18 HTH_AraC dCache_1 GGDEF_2 MurB_C IMS SWIRM
Other DBs
NCBI-GeneID: 936234
NCBI-ProteinID: NP_390893
Pasteur: BG13838
BSORF: BG13838
UniProt: O32071 A0A6M3ZFD6
Position
3083441..3085759
AA seq 772 aa
MGGFMKRSQYKFYYKLITFFCLLSTIPVILVGLFSYEHSQKTAISNVSEEKFDTLQQTQQ
SIEHILKTVDHSLTHYVSSPPLLRTLSEPLHSDQFQIYNQVNQELNYLQSFDTDLSNMTL
VSYTKKWYMNNSGLYRLNTDTLHEAASAYTKQKASRSYWTLEENNHLISTKEGTAENCRY
NINLIKQLPLNSTNTKGLAAASIPSCSLVKNMPGYSNANNLFIIDEKGLIILHNNMSDVG
ESLHNDGFVQKVLAQTANSGQFETVIDRIHYKVTYQKSDYNAWTYFSLVSLPELKKEAKS
IGWITFAVCLILLTLSLLFSWLGSRHFYKPIRVLYESFARHGAIQEKQQPPQNEFELIEQ
SFKQLKDRNDDLEETMKQQATHLQQYFMVRLMLGKLTDEEVDNRFESLGLKQNWRHLALL
VLQIDTLNHTPYEKKDMDLLLFAVNSLIERNIPTDKHLAPAVVDKQQATILINQSGTKEE
FMAELNETARMIQEKAEAELQLSVSIGISQPFDVLTKAKTAYAEGSEALKYRLKAENKSI
IFYEDLDQKKTFKTHFPKQLQHELFDAVKAGDKEKADKCLHAILQAIFTQNTNPYQFQIA
IARFLNHVIELMHVLGIELFELEENKMLYDQIFELKTFEDTENWLKNEFIDPMTDKVNAR
ADAQYKNISDNIIHIIHHEFESELTLDEIARRLHYNPNYLSSIFKKEMGISFSEYVSSYR
HHMAKSWLAETDMAVKDIAEKLKYKNSQNFIRSFKKLEGITPGNYRQQKRSM
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggggggttttatgaaaagaagccaatacaagttttactacaaactgatcacgtttttc
tgcctgctcagcaccattccggttattttggtcggattattttcgtacgagcactctcag
aaaacggctatttccaacgtttcggaggaaaaattcgacacactccagcagacccagcaa
agcatcgagcatatattgaaaaccgtcgatcactctttaacccactatgtgagttcgccg
cctctccttcgcacattgtccgagcctttgcactcagaccaatttcaaatctataaccaa
gtgaaccaagagctcaattatctgcaaagctttgataccgatctgtccaacatgacgtta
gtcagttatacgaaaaaatggtacatgaacaattccggtttgtaccgtttgaatacagac
actcttcatgaagcagcctcagcgtacacgaaacaaaaagcgagccgctcctattggacg
cttgaggaaaacaatcatttgatttcaaccaaagaaggcacagcagaaaactgccgctac
aatatcaatttaattaagcagcttcctttgaacagcacaaatacaaagggattggccgcc
gcaagcatcccgagctgttcgcttgtcaaaaatatgcccggctattcaaacgccaacaac
ctgtttatcatcgatgaaaaaggcctcatcatccttcataacaatatgtctgacgttggt
gaatctcttcataacgacggctttgtccaaaaagtgctggcgcaaacggccaatagcgga
cagtttgaaacagtgattgaccggattcattataaagtcacctatcaaaaatctgactat
aatgcatggacttatttttctctcgtttccctgcctgagttaaaaaaagaagccaaatca
atcggctggatcacttttgcagtatgcctcattttgttaacgctttcattgctgttctct
tggcttggctcccgccatttttacaagccgatcagggtgctttacgaatcattcgcaaga
catggagccatacaagagaaacaacagcctcctcaaaatgaatttgagttaattgaacag
agctttaagcagctgaaggacagaaatgacgaccttgaagaaacgatgaagcagcaggcc
actcatctgcagcaatattttatggtcaggcttatgcttggaaaactgacggatgaggag
gttgataaccgttttgaaagcctcggcttaaagcaaaattggcggcaccttgccctgctt
gtgctccaaattgacacactgaatcatacgccttatgagaaaaaagatatggatctgctt
ttgtttgccgtcaacagcctgattgagcgcaacatcccgacggacaaacatcttgccccc
gccgtagttgacaaacagcaggcgacgattttgatcaatcaaagcgggacaaaggaagaa
ttcatggctgagctgaatgagactgcaaggatgattcaggaaaaagcggaagctgagctg
cagctgtctgtcagcatcggcatcagccagccgtttgatgtgctgacaaaagcgaaaaca
gcctatgcggaaggctcagaagcgttgaaatatcggctgaaagcggaaaacaagtcgatc
atcttttacgaagaccttgaccagaaaaaaaccttcaaaacccattttccaaagcagctt
cagcatgagctgttcgatgctgtcaaagcaggagacaaggagaaagcggataaatgcctg
cacgcgattttacaagccattttcacccagaacaccaacccgtatcaatttcaaatcgcc
atcgcccgttttttgaaccatgtgattgagctgatgcatgtgcttgggatcgaattgttt
gagcttgaagaaaacaaaatgctgtatgaccaaatttttgagctgaaaacgttcgaggat
accgaaaactggctaaagaatgagtttattgatccgatgacagacaaagtgaacgcccgc
gcggatgcccagtacaaaaatatttccgacaacatcattcatatcatccatcatgagttt
gaatccgaattgacactggacgaaatcgcacgcaggctgcattacaacccaaattattta
agcagtattttcaaaaaagaaatgggaatttcattcagcgagtatgtctcaagctaccga
caccatatggcgaaaagctggcttgccgaaaccgacatggcggtcaaggacattgccgaa
aagctgaaatataaaaactcccaaaacttcatcagatcatttaagaagctggaagggatt
acaccgggaaactaccgccagcaaaaaagaagcatgtaa

DBGET integrated database retrieval system