KEGG   Bacillus subtilis subsp. subtilis 168: BSU30340Help
Entry
BSU30340          CDS       T00010                                 

Gene name
ytvA
Definition
(RefSeq) blue-light photoreceptor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_9 PAS STAS PAS_8 PAS_3 PAS_4
Motif
Other DBs
NCBI-GeneID: 937254
NCBI-ProteinID: NP_390912
Pasteur: BG13928
BSORF: BG13928
UniProt: O34627
Structure
PDB: 

Position
3106210..3106995
Genome map
AA seq 261 aa AA seqDB search
MASFQSFGIPGQLEVIKKALDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGK
NCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFV
GIQNDITKQKEYEKLLEDSLTEITALSTPIVPIRNGISALPLVGNLTEERFNSIVCTLTN
ILSTSKDDYLIIDLSGLAQVNEQTADQIFKLSHLLKLTGTELIITGIKPELAMKMNKLDA
NFSSLKTYSNVKDAVKVLPIM
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctagttttcaatcatttgggataccaggacagctggaagtcatcaaaaaagcactt
gatcacgtgcgagtcggtgtggtaattacagatcccgcacttgaagataatcctattgtc
tacgtaaatcaaggctttgttcaaatgaccggctacgagaccgaggaaattttaggaaag
aactgtcgcttcttacaggggaaacacacagatcctgcagaagtggacaacatcagaacc
gctttacaaaataaagaaccggtcaccgttcagatccaaaactacaaaaaagacggaacg
atgttctggaatgaattaaatattgatccaatggaaatagaggataaaacgtattttgtc
ggaattcagaatgatatcaccaagcaaaaagaatatgaaaagcttctcgaggattccctc
acggaaattactgcactttcaactcctattgtcccgattcgcaatggcatttcggctctt
ccgctagtcggaaacctgacagaggagcgatttaattccatcgtttgcacattgacgaat
atcttatcaacatccaaagatgattatttgatcattgatttatccggattggcccaagtg
aacgaacaaacggccgaccaaattttcaagctgagccatttgctgaaattgaccggaact
gagttaatcattactggcattaagcctgaattggctatgaaaatgaataaactggatgcc
aatttttcgtcgctgaaaacatattcaaatgtaaaggatgccgttaaagtgcttccgatt
atgtaa

DBGET integrated database retrieval system