KEGG   Bacillus subtilis subsp. subtilis 168: BSU30340
Entry
BSU30340          CDS       T00010                                 

Symbol
ytvA
Name
(RefSeq) blue-light photoreceptor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PAS_9 PAS_8 PAS STAS PAS_3 PAS_4
Other DBs
NCBI-GeneID: 937254
NCBI-ProteinID: NP_390912
Pasteur: BG13928
BSORF: BG13928
UniProt: O34627 A0A6M4JMT0
Structure
PDB: 
2PR5 2PR6 2MWG

Position
3106210..3106995
AA seq 261 aa
MASFQSFGIPGQLEVIKKALDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGK
NCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFV
GIQNDITKQKEYEKLLEDSLTEITALSTPIVPIRNGISALPLVGNLTEERFNSIVCTLTN
ILSTSKDDYLIIDLSGLAQVNEQTADQIFKLSHLLKLTGTELIITGIKPELAMKMNKLDA
NFSSLKTYSNVKDAVKVLPIM
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctagttttcaatcatttgggataccaggacagctggaagtcatcaaaaaagcactt
gatcacgtgcgagtcggtgtggtaattacagatcccgcacttgaagataatcctattgtc
tacgtaaatcaaggctttgttcaaatgaccggctacgagaccgaggaaattttaggaaag
aactgtcgcttcttacaggggaaacacacagatcctgcagaagtggacaacatcagaacc
gctttacaaaataaagaaccggtcaccgttcagatccaaaactacaaaaaagacggaacg
atgttctggaatgaattaaatattgatccaatggaaatagaggataaaacgtattttgtc
ggaattcagaatgatatcaccaagcaaaaagaatatgaaaagcttctcgaggattccctc
acggaaattactgcactttcaactcctattgtcccgattcgcaatggcatttcggctctt
ccgctagtcggaaacctgacagaggagcgatttaattccatcgtttgcacattgacgaat
atcttatcaacatccaaagatgattatttgatcattgatttatccggattggcccaagtg
aacgaacaaacggccgaccaaattttcaagctgagccatttgctgaaattgaccggaact
gagttaatcattactggcattaagcctgaattggctatgaaaatgaataaactggatgcc
aatttttcgtcgctgaaaacatattcaaatgtaaaggatgccgttaaagtgcttccgatt
atgtaa

DBGET integrated database retrieval system