KEGG   Bacillus subtilis subsp. subtilis 168: BSU30420
Entry
BSU30420          CDS       T00010                                 

Symbol
ytrE
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K16920  acetoin utilization transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30420 (ytrE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30420 (ytrE)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Acetoin utilization transporter
    BSU30420 (ytrE)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 RsgA_GTPase AAA_29 AAA_22 MMR_HSR1 G-alpha AAA_23 Dynamin_N ATP-synt_ab Zeta_toxin AAA_30 T2SSE NACHT AAA_10 Rad17 ABC_ATPase AAA_15 NB-ARC DUF87
Other DBs
NCBI-GeneID: 937245
NCBI-ProteinID: NP_390920
Pasteur: BG13915
BSORF: BG13915
UniProt: O34392 A0A6M4JKN6
Position
complement(3115279..3115974)
AA seq 231 aa
MIDVQHIDHSFTIGKKGRENEVPVLKDVSLSVAKGEIACIVGRSGSGKSTLLNLISGYIS
PTKGRIVINGTDVTGFNEKEWAQFRLDHFGFIFQSFQLIPGLTTYENVEMPLALKGIKPS
ERKQKVQDMLKRVGLENHAAHYPNELSGGQQQRVSIARALILNPSIILADEPTGSLDSET
EHEVLELIQQLNRERGITFVIITHDDEVASIGHSKFQLHDGVLKGGITVEV
NT seq 696 nt   +upstreamnt  +downstreamnt
atgattgatgttcagcatatcgaccattctttcacgatcggaaaaaagggccgtgagaat
gaagttccagtattgaaggatgtttcattgagcgtggcgaaaggggaaatcgcctgcatt
gtcggacgaagcggctcagggaaatcaacgcttttgaatttaatttccggctacatatcg
ccgacaaaagggcggattgtcattaatggcactgatgttacggggtttaatgaaaaggaa
tgggcgcaatttcggcttgaccatttcgggtttatttttcagagctttcagctcatcccg
ggtttaacgacgtatgagaatgtggaaatgccgctggcgttaaaaggaatcaagccatct
gagcggaagcaaaaggtgcaggacatgctgaaacgcgtcggtctggaaaaccacgccgct
cattatccgaatgaactgtcaggcggccagcagcagcgtgtcagtattgctcgagcattg
attttaaatccttcgattatcttagcggatgagccgacgggaagccttgattcagaaacg
gaacatgaagtgctggaattgatccagcagctgaatcgtgagcgtggcattacatttgtg
atcattactcacgatgatgaagtcgcttctatcggacattcaaaatttcagcttcatgat
ggtgtgctaaaaggaggaattaccgttgaggtttaa

DBGET integrated database retrieval system