KEGG   Bacillus subtilis subsp. subtilis 168: BSU30580
Entry
BSU30580          CDS       T00010                                 

Symbol
ytmA
Name
(RefSeq) peptidase YtmA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_S9 DLH Abhydrolase_2 BAAT_C Peptidase_S15 Hydrolase_4 FSH1 Abhydrolase_1 AXE1 Abhydrolase_3
Other DBs
NCBI-GeneID: 936383
NCBI-ProteinID: NP_390936
Pasteur: BG13881
BSORF: BG13881
UniProt: O34493 A0A6M4JL56
Position
complement(3131446..3132219)
AA seq 257 aa
MIVEKRRFPSPSQHVRLYTICYLSNGLRVKGLLAEPAEPGQYDGFLYLRGGIKSVGMVRP
GRIIQFASQGFVVFAPFYRGNQGGEGNEDFAGEDREDAFSAFRLLQQHPNVKKDRIHIFG
FSRGGIMGMLTAIEMGGQAASFVSWGGVSDMILTYEERQDLRRMMKRVIGGTPKKVPEEY
QWRTPFDQVNKIQAPVLLIHGEKDQNVSIQHSYLLEEKLKQLHKPVETWYYSTFTHYFPP
KENRRIVRQLTQWMKNR
NT seq 774 nt   +upstreamnt  +downstreamnt
ttgattgtagagaaaagaagatttccgtcgccaagccagcatgtgcgtttgtatacgatc
tgctatctgtcaaatggattacgggttaaggggcttctggctgagccggcggaaccggga
caatatgacggatttttatatttgcgcggcgggattaaaagcgtgggcatggttcggccg
ggccggattatccagtttgcatcccaagggtttgtggtgtttgctcctttttacagaggc
aatcaaggaggagaaggcaatgaggattttgccggagaagacagggaggatgcattttct
gcttttcgcctgcttcagcagcacccaaatgtcaagaaggatagaatccatatcttcggt
ttttcccgcggcggaattatgggaatgctcactgcgatcgaaatgggcgggcaggcagct
tcatttgtttcctggggaggcgtcagtgatatgattcttacatacgaggagcggcaggat
ttgcggcgaatgatgaaaagagtcatcggcggaacaccgaaaaaggtgcctgaggaatat
caatggaggacaccgtttgaccaagtaaacaaaattcaggctcccgtgctgttaatccat
ggagaaaaagaccaaaatgtttcgattcagcattcctatttattagaagagaagctaaaa
caactgcataagccggtggaaacatggtactacagtacattcacacattatttcccgcca
aaagaaaaccggcgtatcgtgcggcagctcacacaatggatgaaaaaccgctga

DBGET integrated database retrieval system