KEGG   Bacillus subtilis subsp. subtilis 168: BSU30640
Entry
BSU30640          CDS       T00010                                 

Symbol
ytkC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_holin_4_1 SafA DUF2975
Other DBs
NCBI-GeneID: 937209
NCBI-ProteinID: NP_390942
Pasteur: BG13868
BSORF: BG13868
UniProt: O34883 A0A6M4JMF4
Position
complement(3135668..3136072)
AA seq 134 aa
MDRDFGIFSFLAVSVSAAGFFFGGFQYSFLILLSLMAIEFISTTLKETIIHKLSFKKVFA
RLVKKLVTLALISVCHFFDQLLNTQGSIRDLAIMFYILYESVQIVVTASSLGIPVPQMLV
DLLETLKNKFKRKP
NT seq 405 nt   +upstreamnt  +downstreamnt
atggatagagactttggcatcttttcgtttttagcagtcagcgtttcagcagcgggtttt
ttctttggaggttttcagtattcatttctgattttgctctctcttatggcaattgaattt
atcagtacgactttgaaggaaaccattattcacaaactgtcatttaaaaaggtatttgcc
cggcttgtcaaaaaattagtcacgctggctctgatctctgtatgccacttttttgatcag
ctgctgaatacacagggatcaattcgtgacttggctattatgttttatattctttatgaa
tctgtgcaaattgttgtgacagccagctctcttggcataccggttcctcagatgcttgtc
gatcttttagaaacgttaaaaaataaatttaagcgcaaaccgtaa

DBGET integrated database retrieval system