KEGG   Bacillus subtilis subsp. subtilis 168: BSU30810
Entry
BSU30810          CDS       T00010                                 

Symbol
ytxM
Name
(RefSeq) esterase
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU30810 (ytxM)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     BSU30810 (ytxM)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DLH Thioesterase DUF676 BAAT_C DUF915 Palm_thioest DUF2974 Esterase DUF4392
Other DBs
NCBI-GeneID: 937115
NCBI-ProteinID: NP_390959
Pasteur: BG10685
BSORF: BG10685
UniProt: P23974 A0A6M4JKS7
Position
complement(3149751..3150575)
AA seq 274 aa
MGTVNITVSDGVRYAVADEGPNASEAVVCLHGFTGSKQSWTFLDEMLPDSRLIKIDCLGH
GETDAPLNGKRYSTTRQVSDLAEIFDQLKLHKVKLIGYSMGGRLAYSFAMTYPERVSALV
LESTTPGLKTLGERRERIMRDRKLADFILRDGLEAFVAYWENIPLFSSQQRLAEDIRYRI
RSGRLRNNKIGLANSLTGMGTGSQPSLWSRVEEIDVPVLLICGEWDEKFCAINQEVHKML
PSSRIEIVPKAGHTVHVEQPRLFGKIVSEFLTSI
NT seq 825 nt   +upstreamnt  +downstreamnt
atgggaactgtaaacataacggtatcagatggtgtccgatatgcagtggcagacgaggga
ccgaatgcttccgaagccgtcgtctgtctgcatgggtttaccggcagcaaacaatcatgg
acttttcttgatgaaatgctgcctgattcccgtttgatcaaaattgattgtttagggcat
ggggaaaccgatgccccgctgaatgggaaaagatacagcacaacccggcaagtttctgac
cttgccgagatttttgatcaattaaaacttcacaaagtgaaattgattgggtattctatg
ggaggaaggcttgcttactcttttgcgatgacatatcccgagcgggtatcggcacttgtg
cttgaaagcacgacgccggggctcaaaacacttggggaacggcgggaacgaatcatgcgg
gaccggaagcttgctgattttattttacgagacgggctcgaagcgtttgttgcgtattgg
gagaatatccctttgttttcatctcagcagaggctggctgaagatattcggtacaggata
cgatcgggccgtctgcggaacaataagattgggcttgcgaacagtttaaccggcatgggc
accggttcacagccttccttgtggagccgtgtagaggaaatagatgttcctgtgcttctg
atctgcggggagtgggacgaaaaattttgcgccatcaatcaagaggtgcataagatgctt
ccttctagtagaatagagattgttccaaaagcaggacatacggtccatgtggagcagccg
cgattgtttggtaaaatagtgagtgagtttttgacaagcatctga

DBGET integrated database retrieval system