KEGG   Bacillus subtilis subsp. subtilis 168: BSU31140
Entry
BSU31140          CDS       T00010                                 

Symbol
cdoA
Name
(RefSeq) cysteine dioxygenase
  KO
K00456  cysteine dioxygenase [EC:1.13.11.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00430  Taurine and hypotaurine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU31140 (cdoA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSU31140 (cdoA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.20  cysteine dioxygenase
     BSU31140 (cdoA)
SSDB
Motif
Pfam: CDO_I Cupin_2 PCO_ADO
Other DBs
NCBI-GeneID: 938837
NCBI-ProteinID: NP_390992
Pasteur: BG13952
BSORF: BG13952
UniProt: O32085 A0A6M4JMJ0
Structure
PDB: 
4QM9 4QM8 3EQE

Position
3193863..3194348
AA seq 161 aa
MELYECIQDIFGGLKNPSVKDLATSLKQIPNAAKLSQPYIKEPDQYAYGRNAIYRNNELE
IIVINIPPNKETTVHDHGQSIGCAMVLEGKLLNSIYRSTGEHAELSNSYFVHEGECLIST
KGLIHKMSNPTSERMVSLHVYSPPLEDMTVFEEQKEVLENS
NT seq 486 nt   +upstreamnt  +downstreamnt
atggaactgtatgagtgtatccaagacatttttggcggcttgaaaaatccatcggttaaa
gatttagcaacgtctttaaaacaaattccaaacgcagcaaaattgagtcaaccgtatatt
aaggaaccagaccagtacgcttacggccgaaatgccatctatcgaaataatgaattggaa
attatcgtgattaacattccgccaaacaaggagacaacagtacacgatcatggtcaatcc
attggttgtgcaatggtgttagaaggaaagcttcttaattctatttatcgttcaaccggc
gaacacgcagaactctccaattcatactttgtccacgaaggagaatgccttatttcaacc
aaaggtttaattcacaaaatgtccaatccaacatctgaacgaatggtgtctcttcatgtc
tactcccctcctttggaagacatgacggtctttgaggaacaaaaggaggtattggaaaat
tcatga

DBGET integrated database retrieval system