KEGG   Bacillus subtilis subsp. subtilis 168: BSU31140Help
Entry
BSU31140          CDS       T00010                                 

Gene name
cdoA
Definition
(RefSeq) cysteine dioxygenase
  KO
K00456  cysteine dioxygenase [EC:1.13.11.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00430  Taurine and hypotaurine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU31140 (cdoA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSU31140 (cdoA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.20  cysteine dioxygenase
     BSU31140 (cdoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDO_I Cupin_2 PCO_ADO
Motif
Other DBs
NCBI-GeneID: 938837
NCBI-ProteinID: NP_390992
Pasteur: BG13952
BSORF: BG13952
UniProt: O32085
Structure
PDB: 

Position
3193863..3194348
Genome map
AA seq 161 aa AA seqDB search
MELYECIQDIFGGLKNPSVKDLATSLKQIPNAAKLSQPYIKEPDQYAYGRNAIYRNNELE
IIVINIPPNKETTVHDHGQSIGCAMVLEGKLLNSIYRSTGEHAELSNSYFVHEGECLIST
KGLIHKMSNPTSERMVSLHVYSPPLEDMTVFEEQKEVLENS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggaactgtatgagtgtatccaagacatttttggcggcttgaaaaatccatcggttaaa
gatttagcaacgtctttaaaacaaattccaaacgcagcaaaattgagtcaaccgtatatt
aaggaaccagaccagtacgcttacggccgaaatgccatctatcgaaataatgaattggaa
attatcgtgattaacattccgccaaacaaggagacaacagtacacgatcatggtcaatcc
attggttgtgcaatggtgttagaaggaaagcttcttaattctatttatcgttcaaccggc
gaacacgcagaactctccaattcatactttgtccacgaaggagaatgccttatttcaacc
aaaggtttaattcacaaaatgtccaatccaacatctgaacgaatggtgtctcttcatgtc
tactcccctcctttggaagacatgacggtctttgaggaacaaaaggaggtattggaaaat
tcatga

DBGET integrated database retrieval system