KEGG   Bacillus subtilis subsp. subtilis 168: BSU31240Help
Entry
BSU31240          CDS       T00010                                 

Gene name
mcpA
Definition
(RefSeq) methyl-accepting chemotaxis protein McpA
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31240 (mcpA)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU31240 (mcpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU31240 (mcpA)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU31240 (mcpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal dCache_1 HAMP dCache_2 I_LWEQ Phage_DsbA DUF1664 sCache_3_2 Virul_fac_BrkB LXG DUF16 Folliculin ATG16
Motif
Other DBs
NCBI-GeneID: 937154
NCBI-ProteinID: NP_391002
Pasteur: BG10861
BSORF: BG10861
UniProt: P39214
Position
complement(3206169..3208154)
Genome map
AA seq 661 aa AA seqDB search
MKKILQLIKQRSITRKLLVSFLSILIIPVVILAIFAYQSASSSLDRQMMGSALENVQQLN
EIINTSIGEKENSADYFSEWLTKEKYNAKSNASIAEKFSQYISINKDVESIYTSDTKGHF
TRYPDLPMPSGYNPVERDWYKKAVANKGKVVITDPYKTASTNTMVVTIAQQTKDGSGVIA
INMTIENLLKTTKKVNIGTQGYAFIMTKDKKVVAHPNEQSGTELKGDWLDKMLSADKGDF
QYTMDGDKKKMAFDTNKLTGWKIGGTMYLDEIHEAAQPVLHLALIVLAAAIIIGIIVMTL
IIRSITTPLKQLVGSSKRISEGDLTETIDIRSKDELGELGKSFNNMASSLRSLIHAIQDS
VDNVAASSEELTASAAQTSKATEHITLAIEQFSNGNEKQNENIETAAEHIYQMNDGLTNM
AQASEVITDSSVQSTEIASEGGKLVHQTVGQMNVIDKSVKEAEQVVRGLETKSKDITNIL
RVINGIADQTNLLALNAAIEAARAGEYGRGFSVVAEEVRKLAVQSADSAKEIEGLIIEIV
KEINTSLGMFQSVNQEVQTGLDITDKTEMSFKRISEMTNQIAGELQNMSATVQQLSASSE
EVSGASEHIASISKESSAHIQDIAASAEEQLASMEEISSSAETLSSMAEELRDMTKRFKI
E
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatactccaactcataaaacaaagatcaattacacggaagcttctcgtttcc
tttctgtcgatcctcatcataccggttgtcatattggcgatctttgcgtatcaatcggct
agcagctcactcgacagacagatgatggggagcgcattggaaaatgtacagcaattaaac
gaaatcattaacaccagcatcggcgaaaaagaaaacagtgctgattatttcagcgaatgg
ctgacaaaagagaaatacaatgcaaaaagcaatgcaagcattgcagagaaattctcacaa
tatatcagcattaacaaggatgtagaatccatttatacaagtgacacaaaagggcacttt
acccgctatccggatcttccgatgccaagcggctataatccggttgaacgcgactggtac
aaaaaagcggttgcaaataaagggaaagtcgtgatcacagacccttataaaaccgcgtcg
acaaatacgatggttgtgacaatcgcccagcagacaaaagatggttcaggcgttatcgca
atcaacatgacgattgaaaatctgctgaaaacaaccaaaaaagtcaacatcggcacacaa
ggctacgcatttatcatgacgaaggacaaaaaagttgtcgcacaccctaatgaacaatca
ggaactgaattaaaaggcgactggctcgataagatgttgagtgctgataaaggcgatttt
caatacaccatggatggcgataagaaaaaaatggcctttgacacaaacaagttgacggga
tggaagatcggcggcaccatgtatttggatgaaatccatgaggcagcccagcctgtcctt
caccttgctttaattgtcttggccgcagctattatcatagggattatcgtcatgacattg
atcattcggtcgattacaacaccgctgaaacagcttgtcggttcctctaagcggatcagc
gagggagatttgacggaaaccattgatatccgttcaaaagatgaattgggcgagctcggc
aaaagctttaacaatatggcgtcgtcacttcgttctctcatacacgccatccaggattcg
gtagacaatgttgccgcttcctctgaggagctgactgcatcagctgcgcaaacgagcaag
gcaacagagcacattacattggcgattgaacaattttctaacggcaatgaaaaacaaaac
gaaaacattgaaacggcagcagagcacatttatcaaatgaatgacgggttgacgaatatg
gctcaagcttctgaagtgatcactgattcatctgttcaatcgacagaaattgcaagtgaa
ggcggcaagcttgttcatcaaaccgtcggccaaatgaatgtcattgacaagtccgttaaa
gaagcggagcaagtcgtacgcggattggaaacgaaatcgaaagatattacaaacattttg
cgtgtgatcaacggcatcgcagaccagacgaacctgcttgccttaaacgcagcaattgaa
gcagcgcgcgcaggcgagtacggccgcggcttctccgttgtagcggaagaagtaagaaaa
ctggcagtacagtcagcagattcagcaaaagagattgaaggattaatcatcgaaattgtg
aaggaaatcaatacatcactcggcatgttccaatctgtcaatcaagaggtgcagacagga
cttgacatcacagataaaacagaaatgagcttcaaacgcatttctgaaatgacgaaccaa
atcgccggcgaactgcaaaatatgagtgcgacggttcagcagctttctgccagctccgaa
gaagtttcgggagcgtctgagcacattgcatcgatttcaaaagaaagctcagcgcatata
caagatatcgcggcgtcagctgaagagcagctagcttccatggaagaaatcagctcgtct
gcagagaccctttcctctatggcggaagagcttcgggatatgaccaaacgatttaaaatt
gaataa

DBGET integrated database retrieval system