KEGG   Bacillus subtilis subsp. subtilis 168: BSU31470Help
Entry
BSU31470          CDS       T00010                                 

Gene name
kapD
Definition
(RefSeq) 3'-5' exonuclease KapD
  KO
K06348  sporulation inhibitor KapD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU31470 (kapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051 Erp_C
Motif
Other DBs
NCBI-GeneID: 937171
NCBI-ProteinID: NP_391025
Pasteur: BG12358
BSORF: BG12358
UniProt: O05231
Position
complement(3231812..3232429)
Genome map
AA seq 205 aa AA seqDB search
MTTNSLLIIDFEFTMPDGKYSPQNFFPEIIEAGIVKSIDDEVVETFSSYVRPKKFPKLTK
RCKSFLKITQKQVDEGMRFEDFIRKLNELDPEKNSTIITWGNMDMKVLKQNCMFNHIPFP
FKGEMRDLSLEYKNFFGDRTLTGLWKAAEEYGDSGTGTHHKALDDALTAYKLFKLVEQDK
QYLEKPKPPTIGERIDLTELLKRAT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacaaacagcttactcattattgatttcgaatttacaatgcctgatggaaagtac
agtcctcaaaacttcttcccggaaatcattgaagccggaattgtaaagtcgattgatgat
gaagtggttgagacgttttctagctatgttagaccgaaaaagttcccgaagcttacgaaa
cgctgcaaatcatttttaaaaataacccaaaaacaggtagacgaaggaatgagattcgag
gatttcatccgtaaactaaacgagctggatcctgagaaaaacagcacaattattacgtgg
ggaaacatggatatgaaagtgctgaagcaaaactgtatgtttaaccatatccctttcccg
tttaagggagaaatgagagatttatcgcttgaatacaaaaacttttttggagaccggaca
ttgacgggtttatggaaagctgccgaagagtatggagattccggaaccggcacccatcat
aaagcgcttgatgatgctctcacagcatataaactttttaagcttgttgagcaggataag
cagtatctcgaaaagccaaaaccgcccacaatcggcgagagaatcgatttaaccgaactg
ttgaagcgcgcgacgtaa

DBGET integrated database retrieval system