KEGG   Bacillus subtilis subsp. subtilis 168: BSU31520Help
Entry
BSU31520          CDS       T00010                                 

Gene name
yufL
Definition
(RefSeq) sensor histidine kinase
  KO
K11614  two-component system, CitB family, sensor histidine kinase MalK [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00490  MalK-MalR (malate transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31520 (yufL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU31520 (yufL)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU31520 (yufL)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU31520 (yufL)
Protein kinases [BR:bsu01001]
 Histidine kinases
  CitB family [OT]
   BSU31520 (yufL)
Two-component system [BR:bsu02022]
 CitB family
  MalK-MalR [MD:M00490]
   BSU31520 (yufL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_3_2 HATPase_c SPOB_a HATPase_c_5 dCache_3 PAS HATPase_c_3 dCache_1 sCache_3_3 PAS_4 HATPase_c_2 PAS_8 Conotoxin CLN3
Motif
Other DBs
NCBI-GeneID: 937173
NCBI-ProteinID: NP_391030
Pasteur: BG12347
BSORF: BG12347
UniProt: O05250
Position
3237157..3238758
Genome map
AA seq 533 aa AA seqDB search
MKKTLKLQTRLTIFVCIVVLIALLITFFTVGAQTTKRIRDQEKATALQTAEMVAEAPMTA
AALESGKKQKELQSYTKRVQKITGTEFVVVMDMNGIRKTHPDPSKIGKKFRGGDESEVLK
GHVHISTASGTLGKSQRAFVPVYAENGKQVGAVAVGITVNEIDEVISHSLRPLYFIICVS
IFVGVIGAVIVARTVKNIMYGLEPYEIATLLEERSAMLESTKEGILAVDEHGKIKLANAE
AKRLFVKMGINTNPIDQDVDDILPKSRLKKVIETKKPLQDRDVRINGLELVFNEVPIQLK
GQTVGAIATFRDKTEVKHLAEQLSGVKMYANALRAQSHEFMNKLHVILGLVQLKEYDDLG
DYIKDIAIQQKSETSEIINDVKSSVLAGFLLGKQSFIREQGANLDIECNGVIPNAADPSV
IHELITIIGNLINNGLDAVADMPKKQITMSMRFHNSILDIEITDTGAGMSEEDQAKVFEQ
GYSTKGKNRGFGLYFTQQSIENLKGQMILTSEKNEGTTFSIRIPYEPKEENHD
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacattaaaactgcaaaccagactcaccatatttgtttgtatcgttgtatta
atcgcattgctcattacgttttttacagtcggtgcccaaaccaccaaacgaattagagat
caggaaaaggccactgcgctgcagactgctgaaatggtagctgaagcgccgatgacagcc
gctgctttagaaagcggaaaaaaacaaaaggaactgcagagctacacaaagcgggttcag
aaaattaccggcacggaatttgttgtcgtcatggatatgaacggtatccgcaaaactcat
cctgacccgagcaaaatcggaaaaaaattcagaggcggtgatgagtccgaggtattaaaa
gggcatgtccatatcagcacagcctctggcacgctcgggaaatcgcagagagcgttcgtc
cctgtctacgcggagaatggaaaacaggtcggtgcagtcgcggtcggcatcaccgtaaat
gaaattgatgaagtgatcagccatagcttacggccgctttactttattatttgcgtcagc
atcttcgtcggtgtgatcggagccgttatcgtcgcccgtacagtgaaaaatatcatgtac
ggacttgaaccttatgaaattgcgactctgcttgaagaacggagcgcgatgctggaatcg
acgaaggaaggaatactcgctgtcgatgaacatggcaaaattaaacttgccaacgcggaa
gcaaaacgcctattcgtcaaaatgggcatcaacacaaatcccattgatcaggatgtagat
gacatcttgccgaaaagccgcttgaaaaaggtcattgagacaaaaaaacctcttcaagac
agagacgtccgcattaacgggctggagcttgtgtttaatgaagttcctatccagctgaaa
ggacaaactgtcggagcgattgcaacattccgcgacaagaccgaggtaaaacatttagct
gaacagctttccggtgttaaaatgtatgcaaacgcactgagagcgcagtctcatgaattt
atgaacaaactgcatgtgatattaggtctcgtccagctgaaagagtatgatgatcttgga
gattatattaaagatatagccatacagcaaaaatcagaaacaagtgaaattataaatgat
gtcaaaagctccgtactggccggttttctgcttggaaagcaaagctttatacgtgagcag
ggcgcaaatcttgatattgaatgcaacggtgtcatcccgaacgcggcagacccttctgtc
atccatgaacttattacaatcatcggaaatctcatcaacaatggcttagatgccgttgcc
gatatgccgaaaaaacaaatcaccatgtccatgcgcttccataacagcatacttgatatt
gaaattaccgatactggagcaggcatgtctgaagaagaccaagccaaagtatttgaacaa
ggctattcaacaaagggcaaaaaccggggattcggcctttatttcacacagcaaagcatc
gaaaatttaaaaggccaaatgatcctcacaagcgaaaagaatgaaggaacgacattcagt
attcgcatcccgtacgaaccgaaggaggaaaatcatgattaa

DBGET integrated database retrieval system