KEGG   Bacillus subtilis subsp. subtilis 168: BSU31570Help
Entry
BSU31570          CDS       T00010                                 

Gene name
yufQ
Definition
(RefSeq) ABC transporter permease
  KO
K02057  simple sugar transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31570 (yufQ)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    BSU31570 (yufQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 Secretin
Motif
Other DBs
NCBI-GeneID: 937176
NCBI-ProteinID: NP_391035
Pasteur: BG12352
BSORF: BG12352
UniProt: O05255
Position
3243657..3244616
Genome map
AA seq 319 aa AA seqDB search
MDIVQILSIIVPATLVYAAPLILTALGGVFSERSGVVNIGLEGLMIIGAFTSVLFNLFFG
QELGAAAPWLSLLAAMAAGALFSLIHAAAAISFRADQTVSGVAINMLALGATLFIVKLIY
GKAQTDKIPEPFYKTKIPGLGDIPVLGKIFFSDVYYTSILAIALAFISWFILFKTPFGLR
IRSVGEHPMAADTMGINVYKMRYIGVMISGLFGGLGGGVYASTIALDFTHSTISGQGFIA
LAALVFGKWHPIGALGAALFFGFAQSLSIIGSLLPLFKDIPNVYMLMAPYILTILALTGF
IGRADAPKANGVPYIKGKR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtggacattgtgcagattttatctatcattgtccctgccacactcgtctatgcggccccg
cttattttaactgctctcggcggcgtgttttccgagagatcaggtgtggtgaatatcggc
ctagaaggcctcatgattatcggggcgttcaccagcgtgttatttaatttattttttggt
caggaattaggtgccgccgcaccttggctttcgctccttgccgccatggcagcaggcgcc
ctgttttcactgattcacgcggcagcggcgatttcgtttcgcgccgaccagacagtcagc
ggtgtcgccattaacatgctggcgcttggggcaactttatttatcgtcaaactgatctac
ggcaaagcgcagacagacaaaattccagagcctttttataagacgaaaatccccggtttg
ggcgatattcccgtcttgggaaagatcttcttttcggatgtctattatacgtctattctt
gcaatagcacttgcctttatttcctggtttatcttgttcaaaacgccgttcggccttcgt
atccgttctgtcggcgagcatccgatggcggccgatacgatgggaatcaacgtatataaa
atgcgctacatcggcgtgatgatcagcggattgttcggcggtctcggcggcggcgtatat
gcctccacaattgcgcttgatttcacgcactctaccatctccgggcaaggttttatcgcc
ctggcagcgcttgtattcggaaaatggcatccgatcggagcactgggggccgccctgttt
ttcggattcgcccaaagcttaagcatcattggatcgctgctccctctttttaaagacata
ccaaatgtgtatatgctgatggctccttatatcttaacgattctcgctttaaccggcttt
atcgggcgggcagatgcgccaaaagccaatggcgtgccttatattaaaggaaaaagataa

DBGET integrated database retrieval system