KEGG   Bacillus subtilis subsp. subtilis 168: BSU31570
Entry
BSU31570          CDS       T00010                                 

Gene name
yufQ
Definition
(RefSeq) ABC transporter permease
  KO
K23536  general nucleoside transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU31570 (yufQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31570 (yufQ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   General nucleoside transporter
    BSU31570 (yufQ)
SSDB
Motif
Pfam: BPD_transp_2 Secretin DUF6234
Other DBs
NCBI-GeneID: 937176
NCBI-ProteinID: NP_391035
Pasteur: BG12352
BSORF: BG12352
UniProt: O05255 A0A6M4JNU8
Position
3243657..3244616
AA seq 319 aa
MDIVQILSIIVPATLVYAAPLILTALGGVFSERSGVVNIGLEGLMIIGAFTSVLFNLFFG
QELGAAAPWLSLLAAMAAGALFSLIHAAAAISFRADQTVSGVAINMLALGATLFIVKLIY
GKAQTDKIPEPFYKTKIPGLGDIPVLGKIFFSDVYYTSILAIALAFISWFILFKTPFGLR
IRSVGEHPMAADTMGINVYKMRYIGVMISGLFGGLGGGVYASTIALDFTHSTISGQGFIA
LAALVFGKWHPIGALGAALFFGFAQSLSIIGSLLPLFKDIPNVYMLMAPYILTILALTGF
IGRADAPKANGVPYIKGKR
NT seq 960 nt   +upstreamnt  +downstreamnt
gtggacattgtgcagattttatctatcattgtccctgccacactcgtctatgcggccccg
cttattttaactgctctcggcggcgtgttttccgagagatcaggtgtggtgaatatcggc
ctagaaggcctcatgattatcggggcgttcaccagcgtgttatttaatttattttttggt
caggaattaggtgccgccgcaccttggctttcgctccttgccgccatggcagcaggcgcc
ctgttttcactgattcacgcggcagcggcgatttcgtttcgcgccgaccagacagtcagc
ggtgtcgccattaacatgctggcgcttggggcaactttatttatcgtcaaactgatctac
ggcaaagcgcagacagacaaaattccagagcctttttataagacgaaaatccccggtttg
ggcgatattcccgtcttgggaaagatcttcttttcggatgtctattatacgtctattctt
gcaatagcacttgcctttatttcctggtttatcttgttcaaaacgccgttcggccttcgt
atccgttctgtcggcgagcatccgatggcggccgatacgatgggaatcaacgtatataaa
atgcgctacatcggcgtgatgatcagcggattgttcggcggtctcggcggcggcgtatat
gcctccacaattgcgcttgatttcacgcactctaccatctccgggcaaggttttatcgcc
ctggcagcgcttgtattcggaaaatggcatccgatcggagcactgggggccgccctgttt
ttcggattcgcccaaagcttaagcatcattggatcgctgctccctctttttaaagacata
ccaaatgtgtatatgctgatggctccttatatcttaacgattctcgctttaaccggcttt
atcgggcgggcagatgcgccaaaagccaatggcgtgccttatattaaaggaaaaagataa

DBGET integrated database retrieval system