KEGG   Bacillus subtilis subsp. subtilis 168: BSU31800Help
Entry
BSU31800          CDS       T00010                                 

Gene name
yueF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport Baculo_PEP_C
Motif
Other DBs
NCBI-GeneID: 936534
NCBI-ProteinID: NP_391058
Pasteur: BG13961
BSORF: BG13961
UniProt: O32095
Position
complement(3262611..3263720)
Genome map
AA seq 369 aa AA seqDB search
MLKSKVHFWTLQILFVLLIIFVATKVSFVFQPFIVFISTLFFPMLIAGILYFIFNPVVRL
LEKKIPRTLSILLIYLLFIGLLAFISASVGPIITAQVTGLFNNLPDYIKQIQALTKDLSH
SQWFTWMMNQDYVSISKIEQSLTSFLQNLPQNITSSLSAVFGVVTNITLVIITVPFILFY
MLKDGHRFPHLAVKILPASYRTEGLKIFKDLSDTLAAYFQGQLLICLFVGTACFIGYLIA
GLPYALILGIVMAITNIIPYVGPFLGAAPAVIVGFMDSPAKALFAIIVVVIVQQLDGNLL
SPLVIGKRLNTHPLTIILLLIGAGSFGGILGMILAVPVYAVVKAFFLNIVRLIKLRQRSR
LEENAKPAE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaaatcaaaagtccatttttggacattgcagattttatttgttttgctgattatt
tttgtagcaacaaaagtttcatttgtatttcagccgtttattgtttttatctcgacattg
tttttcccgatgctaattgcgggaattttgtatttcatatttaatccggtcgtccgcctg
cttgagaaaaaaattccgcggacattatccattctattgatctatttactgtttatcggt
ttgcttgcctttatttcagcgtcagtcggacctatcatcaccgcacaggtgacagggctg
tttaacaaccttcctgattatataaaacagattcaggcgctgacaaaggatttgtcccat
tctcaatggtttacctggatgatgaaccaggattatgtatcgatatcaaaaattgaacag
tcattgacaagttttctccaaaacctgccgcaaaatatcacgtccagtttatctgcggtg
tttggtgtcgtgacaaacatcacgcttgttattattactgttccatttatccttttttac
atgctgaaagacggacaccgctttccgcatttggcagtaaaaattctaccggcttcttat
cggacagaaggcttaaagatttttaaagatttatccgatacgcttgcggcatatttccag
gggcagctgttaatctgtctttttgtcggaacagcgtgttttatcggctatttaattgcc
ggactgccgtatgccctgattcttgggattgtcatggcgattaccaatatcattccctat
gtcgggccttttctcggtgccgcgccggctgtcattgtcggttttatggactcgccggcc
aaagcgctgtttgcgattattgtggtcgtcatcgttcagcagctggacggaaacctgctg
tctcctcttgtgatcggaaagcggctgaatacccatccgcttacgattattttgctatta
atcggagcgggaagcttcggcggaattctcggcatgattttagcggtgccggtttatgcg
gtagtgaaggcgttcttcctgaatattgtccgcttgatcaagctgcgccagcggtcacga
ctcgaggaaaacgcaaagccagctgaatag

DBGET integrated database retrieval system