KEGG   Bacillus subtilis subsp. subtilis 168: BSU31875Help
Entry
BSU31875          CDS       T00010                                 

Gene name
yukB
Definition
(RefSeq) Ftsk domain-containing protein YukB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE FtsK_SpoIIIE_N AAA_22 DUF87 AAA_24 DUF853 SieB TraG-D_C
Motif
Other DBs
NCBI-GeneID: 936565
NCBI-ProteinID: NP_391066
UniProt: C0SPA7
Position
complement(3269914..3274401)
Genome map
AA seq 1495 aa AA seqDB search
MSLLWVFYQNNVQKLNLSNLPSSHPVTIGPDVKDSVTISTIPFNSGVISLKRKESGGQYE
VFLGNDCLGTIETDISFTLQTDQQDIRLILTGSEPEKSVYFTGNRDEIVCSSEKTNADIY
LNPQDFAFAEQSTFSLLRAGGSWSVRPESGTIFLNGEKINANTPLKPGDEIFWNFTQMRV
TEQDLLEIVHYAQFETALTETVKPSTEMQKKYPQYRRTPRMVYDLPDDRVSFSFPSQESD
QTNRGLWLVILPPLVMLIVMGVVAIIQPRGIFILVSLAMFMMTLITSTVQYFRDKNQRKK
REEKRERVYKLYLDNKRKELQALAEKQKQVLEFHFPSFEQMKYLTSEISDRIWEKSLESK
DYLQLRLGTGTVPSSYEINMSGGDLANRDIDDLMEKSQHMQRVYKDIRNAPVTVDLAEGP
MGLVGKSQIVKNEIHQLIGQLSFFNSYHDLRFVFIFHEEEYKDWEWMKWLPQFQMPHIYA
KGFIYNEQTRDQLLSSLYELIRERDLEDDKEKLQFKPHFVFVITNQQLISEHVILEYLEG
QHEHLGISTIVAAETKESLSENITTLVRYINEHEGDILIQKKKAVRIPFRLDHHQREDNE
RFSRTLRTLNHQVGITNSIPETVSFLELFHAKEVKEIGIQQRWLTSESSKSLSVPIGYKG
KDDIVYLNLHEKAHGPHGLLAGTTGSGKSEFLQTYILSLAVHFHPHEAAFLLIDYKGGGM
AQPFRNIPHLLGTITNIEGSKNFSMRALASIKSELKKRQRLFDQYQVNHINDYTKLYKQG
KAEVAMPHLFLISDEFAELKSEEPDFIRELVSAARIGRSLGVHLILATQKPGGIIDDQIW
SNSRFKVALKVQDATDSKEILKNSDAANITVTGRGYLQVGNNEVYELFQSAWSGAPYLEE
VYGTEDEIAIVTDTGLIPLSEVDTEDNAKKDVQTEIEAVVDEIERIQDEMGIEKLPSPWL
PPLAERIPRTLFPSNEKDHFHFAYVDEPDLQRQAPIAYKMMEDGNIGIFGSSGYGKSIAA
ATFLMSFADVYTPEELHVYIFDFGNGTLLPLAKLPHTADYFLMDQSRKIEKFMIRIKEEI
DRRKRLFREKEISHIKMYNALSEEELPFIFITIDNFDIVKDEMHELESEFVQLSRDGQSL
GIYFMLTATRVNAVRQSLLNNLKTKIVHYLMDQSEGYSIYGRPKFNLEPIPGRVIIQKEE
LYFAQMFLPVDADDDIGMFNELKSDVQKLQGRFASMEQPAPIPMLPESLSTRELSIRFKL
ERKPLSVPIGLHEETVSPVYFDLGKHKHCLILGQTQRGKTNVLKVMLEHLIDDETEMIGL
FDSIDRGLSHYAKESDVSYLETKEDIEQWIETAEDIFKTREAMYVEAVRQGDAQNLRFSQ
VVLMIDGITRFQQTIDTRIQDRLANFMKSYAHLGFSFIPGGNHSEFSKGYDSLTTEMKQI
RHAILLMKKSEQNVIPLPYQRQEPEIQPGFGYVVENGKEQKVQIPLCSAERESAR
NT seq 4488 nt NT seq  +upstreamnt  +downstreamnt
ttgagtctattatgggttttttaccaaaataacgttcaaaaattaaatctgtctaacctc
ccgtcgtctcatccggtgaccatagggcctgatgtgaaggattctgttacgatcagcacc
attccatttaatagcggagtgatttctcttaaaagaaaggaatccggcggccaatacgaa
gttttcctgggaaatgattgtctcggcacgattgagacggatatatcatttactctccaa
acggatcagcaggatatacgcttgatattgacgggcagtgaacctgagaaatccgtttat
tttacgggaaatcgggatgaaattgtatgttcctcagaaaaaacgaatgcagatatttat
ctgaatccgcaagattttgcatttgcagaacaaagcacgttttctttgctccgtgcaggc
ggcagctggtcggtccgccctgaaagcggaacgatcttcttgaacggagagaaaatcaac
gccaatacgccgctcaagccgggggatgaaatattctggaacttcacgcaaatgagggtg
acggaacaagaccttttagaaattgttcattatgcccagtttgaaacagcgttaacagaa
acggtcaaaccgagtacagagatgcagaaaaaatatccgcagtacagaagaacgccgcgg
atggtatacgatctgccggatgaccgcgtttctttcagttttccctctcaggagagcgat
caaaccaacagagggctgtggctcgtcatcctgcctccgcttgtgatgctgatcgtgatg
ggcgtagttgccatcatccagccgcgcggcatatttatactcgtttctttggcgatgttt
atgatgactctcattacctcgacagtgcaatatttccgtgataaaaaccagcggaaaaaa
cgcgaggaaaaacgggagcgtgtatataagctttacttagacaataagcggaaagagctt
caggcacttgctgaaaagcaaaagcaggttcttgaatttcactttccttcatttgaacaa
atgaaatacttaacaagtgaaatcagtgaccggatctgggaaaaatcacttgaaagcaag
gattatctccagctgcggcttgggacgggaacagttccgtcaagctatgaaatcaatatg
agtggcggagacttggcgaatcgtgatatcgatgacctcatggagaaatcgcagcacatg
caacgcgtctataaagatatccgtaatgcgccggtgacggtcgatttggcagaaggtccg
atggggcttgtcggtaaatcacaaattgtgaaaaatgagattcaccagctaatcggacag
ctgtcgttctttaacagctatcacgatttgcgtttcgtatttatttttcatgaagaagag
tataaagactgggagtggatgaagtggcttccgcaatttcaaatgccccatatttatgca
aaaggatttatttataatgagcaaacccgagatcagctcctgtcttcactttacgaattg
atcagagagcgtgatctcgaagatgacaaagaaaaactgcagttcaaaccgcattttgta
tttgtcatcacgaatcagcagctgatctctgagcatgtcattctcgaatatttagaaggg
cagcatgagcatctgggcatctcgacaattgtcgctgcagaaacaaaggaaagcttgtcg
gaaaacattacaactcttgtccgctacattaatgagcatgaaggcgacattttaatacaa
aagaaaaaagcggtaagaattccgttccgtctcgatcatcatcagcgtgaggataacgaa
cggttttcacgcacactgcggacgctgaaccaccaggtcggcattacgaattccattccg
gaaacggtatcgttcctggagctttttcatgcgaaggaagtaaaagaaatcggcattcag
caaagatggctgacaagtgaatcgtcgaagtcgctgtcagtgccgatcggctataaaggg
aaagatgacattgtgtatctgaaccttcacgaaaaagcacacggtccgcacggcttgctt
gcggggacaacgggatcagggaaaagtgaatttctccagacctacatcttgtcacttgca
gtgcattttcatccgcatgaagcggctttcttactaattgactataaaggcggaggaatg
gcgcagccgttccgtaacattccccacctcctcggcacgatcacaaatattgaaggaagc
aaaaacttcagtatgcgtgcgcttgcttccattaaaagcgagctaaaaaaaaggcagcgc
ctgtttgaccagtatcaagtcaatcacatcaatgactatacaaagctatacaagcaaggg
aaagcagaagtggcgatgcctcacttgttcttaatttctgatgagtttgccgagctgaaa
agcgaggagcctgattttatcagggagcttgtcagtgccgcgcgtatcggacgaagcctc
ggcgttcatttgattttggcgacacagaagccaggcggcatcatcgacgaccagatctgg
agtaactcgcgctttaaagtagcgctcaaggtccaggatgccaccgacagtaaagaaatt
ttgaaaaacagcgatgccgcaaacattaccgtaacaggccgcggctatttgcaggtcgga
aacaatgaagtgtatgagctgttccaatctgcatggagcggggcgccttacttagaggaa
gtctacggtaccgaggatgaaatcgcgatcgtcacagatacgggtctgatcccgctttct
gaggttgataccgaagataacgcgaaaaaagacgttcaaaccgaaatcgaagctgtagtt
gacgaaattgaacgcatccaagatgaaatgggaatcgagaagctgccaagcccttggctg
ccgccgcttgcggaacgtattccgcgcactcttttcccttcaaacgaaaaagaccatttc
cactttgcgtatgtcgatgaacctgatctgcaaagacaggcgccaattgcttataagatg
atggaagatggaaatatcggcatcttcggctcttcgggctacggaaaatcgattgcagcc
gcaacgttcctgatgagttttgcggacgtatacacacctgaagagcttcatgtctatatc
tttgatttcggaaacggaacgctgctgccattagcgaagctcccgcataccgcggattac
ttcctgatggaccagtcaaggaaaattgaaaagttcatgattcgcatcaaagaagaaatt
gaccgccgtaaacgtttgttccgggaaaaagaaatcagccacatcaaaatgtacaatgcg
ctgagcgaagaagagcttccattcatttttatcaccattgacaactttgacattgtcaag
gatgagatgcatgagcttgaatcggaatttgtccagctttccagagacggacaaagcttg
ggtatctactttatgctgacagcaacgcgggtgaatgctgtccgccagtcattgttaaat
aacttgaaaacaaagattgtccattatctcatggatcaatcagaaggatattccatttac
ggccgtccgaaattcaatcttgagccgattccgggacgcgtcatcattcaaaaggaagag
ctttatttcgcgcaaatgttcctgcctgttgacgccgatgatgatatcggcatgttcaac
gagctgaaatcagacgtacagaaacttcaagggcgatttgcttcaatggagcagccggca
ccgattccgatgctgcctgagagcttgtcgacgagagaattgtctatccgcttcaagctg
gaacgcaagcctttatctgtaccgatcgggcttcatgaagaaacagtcagcccagtctat
tttgatttgggcaagcataagcactgcctgattttaggccaaactcagcgcgggaaaaca
aacgtcctaaaagtcatgcttgaacatctgattgatgatgaaaccgaaatgatcggcctg
tttgactcgattgaccgcggcttatctcattatgcgaaggaatcagatgtttcatatttg
gaaacgaaagaagatattgagcagtggattgaaacagcagaagacattttcaaaacaaga
gaagccatgtatgtagaagccgtccgccaaggagacgcacaaaatctgcgattctcacaa
gtcgtgctgatgattgacgggataacgagattccagcagacgattgatacgagaatacaa
gatcgtctcgctaacttcatgaaatcatacgctcatcttgggttcagctttatcccgggc
ggaaaccacagcgaattctcaaaaggctatgactccttgacgactgagatgaagcaaatc
cgccacgcgattctgctgatgaaaaagtctgagcaaaatgtcattcctctcccgtaccaa
agacaggagcctgagattcagccgggcttcggatatgttgtggaaaacgggaaggagcaa
aaagttcaaattcctttatgttctgctgaaagggagagtgctagatga

DBGET integrated database retrieval system