KEGG   Bacillus subtilis subsp. subtilis 168: BSU31910
Entry
BSU31910          CDS       T00010                                 

Gene name
yukE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: WXG100 T7SS_ESX_EspC EspA_EspE Rho_N Serine_rich PPE DUF5082 UPF0449 Sec34 DUF5344 BshC DUF5917 FapA Mce4_CUP1 DUF5129 PI3K_P85_iSH2 Baculo_PEP_C DUF948 Methyltrn_RNA_4 Frankia_peptide
Other DBs
NCBI-GeneID: 936578
NCBI-ProteinID: NP_391069
Pasteur: BG12378
BSORF: BG12378
UniProt: C0SP85 A0A6M4JMN8
Position
complement(3276141..3276434)
AA seq 97 aa
MAGLIRVTPEELRAMAKQYGVESQEVLNQVDRLNRMISDLKSMWEGASSEAFADQYEQLK
PSFIKMSDLLQDVNQQLDQTANTLESTDQDIANQIRG
NT seq 294 nt   +upstreamnt  +downstreamnt
atggcaggattaattcgtgtcacacccgaagagctaagagcgatggcgaagcaatacggc
gttgaaagccaagaagtattaaatcaggttgatcgtttaaaccgaatgatctctgatttg
aaaagcatgtgggaaggtgcttcaagcgaagcgttcgcagatcaatacgagcagctcaaa
ccttcatttatcaaaatgtcagatttgcttcaagatgtgaatcagcagcttgatcaaaca
gcaaatacacttgagtctactgaccaagacatcgcaaatcaaatccgcggataa

DBGET integrated database retrieval system