KEGG   Bacillus subtilis subsp. subtilis 168: BSU31910Help
Entry
BSU31910          CDS       T00010                                 

Gene name
yukE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WXG100 T7SS_ESX_EspC BLOC1_2 DUF5082 Serine_rich Rho_N LXG PPE UPF0449 Sec34 EzrA DUF5344 FapA APG17 BshC PI3K_P85_iSH2 DUF1664 DUF5129 Zw10 Baculo_PEP_C DUF948 Frankia_peptide
Motif
Other DBs
NCBI-GeneID: 936578
NCBI-ProteinID: NP_391069
Pasteur: BG12378
BSORF: BG12378
UniProt: C0SP85
Position
complement(3276141..3276434)
Genome map
AA seq 97 aa AA seqDB search
MAGLIRVTPEELRAMAKQYGVESQEVLNQVDRLNRMISDLKSMWEGASSEAFADQYEQLK
PSFIKMSDLLQDVNQQLDQTANTLESTDQDIANQIRG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggcaggattaattcgtgtcacacccgaagagctaagagcgatggcgaagcaatacggc
gttgaaagccaagaagtattaaatcaggttgatcgtttaaaccgaatgatctctgatttg
aaaagcatgtgggaaggtgcttcaagcgaagcgttcgcagatcaatacgagcagctcaaa
ccttcatttatcaaaatgtcagatttgcttcaagatgtgaatcagcagcttgatcaaaca
gcaaatacacttgagtctactgaccaagacatcgcaaatcaaatccgcggataa

DBGET integrated database retrieval system