KEGG   Bacillus subtilis subsp. subtilis 168: BSU31960Help
Entry
BSU31960          CDS       T00010                                 

Gene name
dhbF
Definition
(RefSeq) dimodular nonribosomal peptide synthase
  KO
K04780  nonribosomal peptide synthetase DhbF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01053  Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BSU31960 (dhbF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU31960 (dhbF)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Bacillibactin synthetase
    BSU31960 (dhbF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation AMP-binding_C Thioesterase PP-binding Abhydrolase_6 Abhydrolase_1 Hydrolase_4 HicB
Motif
Other DBs
NCBI-GeneID: 936569
NCBI-ProteinID: NP_391076
Pasteur: BG11243
BSORF: BG11243
UniProt: P45745
Position
complement(3280519..3287655)
Genome map
AA seq 2378 aa AA seqDB search
MPDTKDLQYSLTGAQTGIWFAQQLDPDNPIYNTAEYIEINGPVNIALFEEALRHVIKEAE
SLHVRFGENMDGPWQMINPSPDVQLHVIDVSSEPDPEKTALNWMKADLAKPVDLGYAPLF
NEALFIAGPDRFFWYQRIHHIAIDGFGFSLIAQRVASTYTALIKGQTAKSRSFGSLQAIL
EEDTDYRGSEQYEKDRQFWLDRFADAPEVVSLADRAPRTSNSFLRHTAYLPPSDVNALKE
AARYFSGSWHEVMIAVSAVYVHRMTGSEDVVLGLPMMGRIGSASLNVPAMVMNLLPLRLT
VSSSMSFSELIQQISREIRSIRRHHKYRHEELRRDLKLIGENHRLFGPQINLMPFDYGLD
FAGVRGTTHNLSAGPVDDLSINVYDRTDGSGLRIDVDANPEVYSESDIKLHQQRILQLLQ
TASAGEDMLIGQMELLLPEEKEKVISKWNETAKSEKLVSLQDMFEKQAVLTPERIALMCD
DIQVNYRKLNEEANRLARLLIEKGIGPEQFVALALPRSPEMVASMLGVLKTGAAYLPLDP
EFPADRISYMLEDAKPSCIITTEEIAASLPDDLAVPELVLDQAVTQEIIKRYSPENQDVS
VSLDHPAYIIYTSGSTGRPKGVVVTQKSLSNFLLSMQEAFSLGEEDRLLAVTTVAFDISA
LELYLPLISGAQIVIAKKETIREPQALAQMIENFDINIMQATPTLWHALVTSEPEKLRGL
RVLVGGEALPSGLLQELQDLHCSVTNLYGPTETTIWSAAAFLEEGLKGVPPIGKPIWNTQ
VYVLDNGLQPVPPGVVGELYIAGTGLARGYFHRPDLTAERFVADPYGPPGTRMYRTGDQA
RWRADGSLDYIGRADHQIKIRGFRIELGEIDAVLANHPHIEQAAVVVREDQPGDKRLAAY
VVADAAIDTAELRRYMGASLPDYMVPSAFVEMDELPLTPNGKLDRKALPAPDFSTSVSDR
APRTPQEEILCDLFAEVLGLARVGIDDSFFELGGHSLLAARLMSRIREVMGAELGIAKLF
DEPTVAGLAAHLDLAQSACPALQRAERPEKIPLSFAQRRLWFLHCLEGPSPTYNIPVAVR
LSGELDQGLLKAALYDLVCRHESLRTIFPESQGTSYQHILDADRACPELHVTEIAEKELS
DRLAEAVRYSFDLAAEPAFRAELFVIGPDEYVLLLLVHHIVGDGWSLTPLTRDLGTAYAA
RCHGRSPEWAPLAVQYADYALWQQELLGNEDDPNSLIAGQLAFWKETLKNLPDQLELPTD
YSRPAEPSHDGDTIHFRIEPEFHKRLQELARANRVSLFMVLQSGLAALLTRLGAGTDIPI
GSPIAGRNDDALGDLVGLFINTLVLRTDTSGDPSFRELLDRVREVNLAAYDNQDLPFERL
VEVLNPARSRATHPLFQIMLAFQNTPDAELHLPDMESSLRINSVGSAKFDLTLEISEDRL
ADGTPNGMEGLLEYSTDLFKRETAQALADRLMRLLEAAESDPDEQIGNLDILAPEEHSSM
VTDWQSVSEKIPHACLPEQFEKQAALRPDAIAVVYENQELSYAELNERANRLARMMISEG
VGPEQFVALALPRSLEMAVGLLAVLKAGAAYLPLDPDYPADRIAFMLKDAQPAFIMTNTK
AANHIPPVENVPKIVLDDPELAEKLNTYPAGNPKNKDRTQPLSPLNTAYVIYTSGSTGVP
KGVMIPHQNVTRLFAATEHWFRFSSGDIWTMFHSYAFDFSVWEIWGPLLHGGRLVIVPHH
VSRSPEAFLRLLVKEGVTVLNQTPSAFYQFMQAEREQPDLGQALSLRYVIFGGEALELSR
LEDWYNRHPENRPQLINMYGITETTVHVSYIELDRSMAALRANSLIGCGIPDLGVYVLDE
RLQPVPPGVAGELYVSGAGLARGYLGRPGLTSERFIADPFGPPGTRMYRTGDVARLRADG
SLDYVGRADHQVKIRGFRIELGEIEAALVQHPQLEDAAVIVREDQPGDKRLAAYVIPSEE
TFDTAELRRYAAERLPDYMVPAAFVTMKELPLTPNGKLDRKALPAPDFAAAVTGRGPRTP
QEEILCDLFMEVLHLPRVGIDDRFFDLGGHSLLAVQLMSRIREALGVELSIGNLFEAPTV
AGLAERLEMGSSQSALDVLLPLRTSGDKPPLFCVHPAGGLSWCYAGLMTNIGTDYPIYGL
QARGIGQREELPKTLDDMAADYIKQIRTVQPKGPYHLLGWSLGGNVVQAMATQLQNQGEE
VSLLVMLDAYPNHFLPIKEAPDDEEALIALLALGGYDPDSLGEKPLDFEAAIEILRRDGS
ALASLDETVILNLKNTYVNSVGILGSYKPKTFRGNVLFFRSTIIPEWFDPIEPDSWKPYI
NGQIEQIDIDCRHKDLCQPEPLAQIGKVLAVKLEELNK
NT seq 7137 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatacaaaagatcttcaatattctttgaccggggcgcaaactggcatatggttt
gctcagcagcttgatccggacaatccaatctacaatacagcggaatatatagaaatcaat
ggaccagtcaatattgctctttttgaagaagctttgcggcacgtgatcaaggaagcggaa
tcgctgcatgtccgcttcggtgaaaatatggacgggccttggcagatgataaacccgtct
ccggatgtacagctgcacgtcattgacgtcagctctgagcctgatccggaaaaaacagca
ttaaactggatgaaagctgatttagcaaagccggttgatttagggtatgcccctttgttc
aatgaagctctgtttattgccgggcctgatcgtttcttttggtatcagcgcattcaccat
atagcgatcgacggcttcggtttttccctgatagcccagcgtgtggcaagtacatatact
gcccttataaaaggacaaacagctaaaagccgttcctttgggtctctccaggccattttg
gaggaggatacagattatcgcggatcagagcagtatgagaaggatcgtcaattctggctg
gaccgttttgcagatgcacctgaagttgtgagcttggctgatcgggcgccaagaacatct
aacagttttcttcgtcatacggcatatctgcctccgtctgatgtaaacgcgttaaaagaa
gcggcgcgctatttctcaggaagctggcatgaagtcatgattgcggtgtcagctgtttat
gtgcaccgtatgaccggctctgaggatgttgtgctcggcctgcccatgatgggtcggata
gggtccgcgtcactgaatgtaccggctatggtgatgaaccttctcccgctccggctgacg
gtaagctcttcgatgagcttttctgaactgattcagcaaatttcccgggaaatccgcagt
attcggcgacatcataagtatcgccatgaagagcttaggcgcgatctgaaattgatagga
gaaaatcatagattatttggccctcaaatcaatcttatgccgtttgattacggtctcgac
tttgccggcgtccggggcacaacgcataatctttcagccggtcctgttgatgatctatca
atcaatgtatatgacagaacagacggcagcgggctgcgaattgatgttgatgcgaatccc
gaggtatacagtgagtctgatattaagcttcatcagcagcgtattttgcagctgctgcaa
acggcttctgccggagaggacatgctgattgggcaaatggagcttctgttgccagaggag
aaagaaaaagtcatttctaaatggaatgagacggcaaaatccgagaagctggtcagcctt
caggacatgttcgaaaagcaggcagttcttacgccagaacgtatcgctctcatgtgtgat
gacattcaagtcaactatcgaaagctcaatgaagaggcaaaccgcctcgcgcgtctgttg
atcgaaaaagggattggtccggagcaatttgtcgctttggcgctgccgcgttcccctgag
atggtggcttcaatgcttggtgtgctcaagactggtgcggcgtatctcccccttgatccg
gagtttccagccgaccgcatttcttacatgctggaggatgcgaaaccttcatgcatcata
acgactgaggaaatagcagccagtctgcctgatgacctggctgtacctgagcttgtgctt
gatcaggctgttacacaggagattataaaacgctattcgccggaaaatcaggatgtatcg
gtttcgcttgaccatcctgcgtatatcatctatacctcaggatcaacaggaagaccgaag
ggagtcgttgtgacacagaaaagcttaagcaattttctgctgtctatgcaggaggcattt
tctctaggagaagaagacaggctgttggctgtgacgactgtcgcttttgatatttcagca
ttggagttatatcttccgctgattagcggagcgcaaatcgtgatcgcaaagaaagaaacg
atccgtgagccgcaggcattagctcaaatgattgaaaatttcgatattaacattatgcag
gcgacaccgacactgtggcacgctttggtaacgagtgaacctgagaaacttcgggggctt
agagtgcttgtaggaggcgaggcgctgccgagcggtcttttgcaggaacttcaagacctt
cattgttcagtcacgaacttatacggtcccactgaaacaacgatttggtctgccgcagct
tttcttgaagaagggctgaagggcgttcctccgattgggaaaccgatttggaacacgcag
gtgtatgtgcttgataatggattgcagccggtgccgccgggcgttgtcggagagctttat
attgcaggaaccggcttggccagaggttatttccatcgtcctgatttaacggcggagcgc
ttcgttgcagatccatacggaccgccgggaactcggatgtatcggaccggagaccaggcc
cgctggcgcgccgatgggtctttggattatatcgggcgggcggatcatcaaatcaaaatt
cgcggattccgaattgaacttggagaaattgatgccgtgcttgccaatcacccgcacatt
gaacaggccgcggttgtcgtacgggaagatcagccgggagacaaacgattggcggcttat
gtagtcgctgatgctgctattgatactgcagagcttcgtcgttatatgggggctagtctt
cctgattatatggtaccgtcggcgtttgtggagatggacgagctgccgttaacacctaat
ggcaagcttgaccggaaagcactgccggcaccagacttcagcacatctgtcagtgatcgg
gccccgcggactcctcaggaagagatattgtgtgacttgtttgcagaggttctcggtttg
gcacgcgtcggtatcgatgacagtttcttcgagcttgggggccattctcttcttgcagcc
cgtctgatgagccgcattcgcgaggtaatgggagccgaacttggtatcgccaagctcttt
gacgaaccgacagtagccggactcgctgcccatcttgatttggcgcagagtgcatgtccc
gctttgcagagagctgagcggcctgaaaagatcccgctctcatttgcccagcgccggcta
tggttcctgcattgtctggaaggaccgagtcctacttataatattccggttgctgtccgt
ttgtcaggtgagttggatcaaggattgctgaaagcggcactttatgacctcgtctgccgt
catgaaagtcttcggacgatcttccctgaatcacaggggacatcctatcagcatatttta
gatgccgatcgagcctgtcccgagttacatgttactgaaattgctgagaaggagctttct
gatcggcttgccgaagctgtacgctacagctttgatcttgcagctgaacctgcttttcgt
gccgagctttttgtgatcggtcctgacgagtacgtgctgcttcttctcgtccatcatatt
gtcggggacggctggtccttaacaccgctgaccagagaccttgggacagcttatgcggct
cgctgccacggacgatctcccgaatgggcgcctcttgctgtgcagtatgcagactatgcg
ctttggcagcaagaactgcttggaaacgaggatgatccaaatagcttgattgccggacag
cttgctttctggaaagaaaccttgaaaaacctgcctgatcagcttgaactgccaaccgat
tattcacgtccggctgagccgagtcatgatggagatacgattcattttcgtattgagccc
gagtttcacaagcgattgcaggagctggctcgcgcaaatagggtgagcctgtttatggtg
cttcaatccggtctcgccgctttattgacaaggctcggggcgggcaccgacattccgatc
ggcagtccgatcgcgggacggaatgatgatgcgctgggcgatcttgtagggctgttcatt
aatacattggtgctcagaactgatacgtccggtgacccaagctttcgtgagcttctagac
agagtacgggaagtgaatctggccgcctatgacaatcaggatctgccgtttgagagactt
gtagaggtgctcaatccggctcgttcgcgtgcgacgcatcctttattccaaatcatgctt
gcgttccaaaacacaccggacgctgaactgcatcttcctgatatggagagcagcctgcga
atcaacagtgtcggttctgccaagtttgatttgacgctggaaattagtgaagatcgcctt
gctgacgggacaccaaacggaatggaaggactgcttgaatacagcactgatcttttcaaa
cgggaaactgctcaggctcttgctgaccgattgatgcgcctgttggaggctgccgagtct
gatcctgacgagcaaatcggaaatctggatattcttgcgccagaggaacacagcagcatg
gtgactgattggcaaagtgtatctgaaaagattccgcacgcatgtttgccagagcaattt
gagaagcaggctgctttacgtcctgatgccattgccgttgtatatgaaaatcaggaactg
agctatgcagagctgaatgaaagagcaaaccggcttgcccgaatgatgattagtgaaggt
gtcgggccggagcaatttgtggcattggcactgccccgatcgttggaaatggctgtcggc
ctattggcggtgctaaaggccggggcagcttatctccctcttgatccggattatccggct
gatcgaattgcttttatgctaaaagatgcacagcctgcgtttatcatgacgaacactaaa
gctgcaaatcacattccgccagttgaaaacgtgccgaaaatcgtgctggatgatcccgag
ctggcagagaaactaaacacgtaccctgcaggtaatccaaaaaataaggataggactcag
ccgctttcccctttgaatacggcatatgtcatttatacatccggctcaacaggtgttcca
aaaggtgtgatgattcctcaccaaaatgtaacacgtttatttgcagcgaccgagcactgg
ttccgtttcagctcaggtgatatctggaccatgttccattcctatgcgtttgatttttcg
gtgtgggagatctggggtcctctgctgcatggcggacgtcttgtaatcgtgcctcaccac
gtcagcagatcgccagaagcgtttctgcgcctgcttgtcaaagagggggtgactgttctg
aaccagacaccgtctgctttctatcagtttatgcaggcggaacgggaacagccggatctc
ggacaggcactcagtctgcgctatgtcatttttggcggagaagcgcttgaactcagccgt
ttagaggattggtacaaccgccaccctgaaaatagaccgcagcttatcaatatgtatggt
attacagaaacgacggtgcatgtgagctatatcgaattagaccgaagcatggcagcttta
cgggcaaacagcttgatcggctgcggcattcccgatcttggtgtatacgtgctggatgaa
cgcctgcagccggtcccgccgggtgttgccggagagctgtatgtatcaggagcggggtta
gcacgaggttatctaggccggcctggtttaacatctgaacgcttcatagctgatccgttc
ggtcctccaggcacccggatgtaccgcactggggatgtggcccgcctccgcgctgacggt
tctctcgactatgtcggccgtgcagaccatcaagtgaaaattcggggattccggattgaa
ttgggagaaattgaagccgcgcttgttcagcatccgcagcttgaagatgcggcagtgatc
gttcgtgaggatcagccgggagataaacggttagcagcttatgtcatcccttcggaagaa
acatttgatacggcggaactgcgcagatatgctgctgagagactgccggattacatggtg
cctgctgcctttgtgacgatgaaagaattgccgctgacaccgaatggaaagcttgatcgt
aaagcgctgcccgctccggatttcgcagcggcagtgacaggacgaggaccgagaacgccg
caggaagaaattctctgtgacctctttatggaggtgcttcacttgccgcgtgtcggcatt
gatgaccgtttctttgatttaggcggacattccttgcttgctgtacagctcatgagccgc
attcgtgaagcgctcggcgttgaactcagcatcggcaacttgttcgaagcacctactgta
gccgggctcgctgaaagacttgaaatgggatcaagccaaagcgctcttgacgttctgctg
ccgctccgaacaagcggagacaagcctcctttattctgtgttcatccggcaggggggctc
agctggtgttatgccggtttgatgaccaatataggaacagattatccgatctacggcttg
caggcacggggaatcgggcagcgcgaggagcttccgaaaacacttgatgacatggctgcc
gattacattaaacaaatccgaacggtccagccaaaaggcccgtaccatctgctgggctgg
tccctgggcgggaatgtcgttcaagcgatggctacccagctgcaaaatcaaggagaagaa
gtatccctgttggtgatgctggacgcctatccgaaccacttccttcctataaaagaggca
ccggatgatgaggaagcgcttattgcccttctggcgttaggcgggtatgatccagacagc
ttaggggaaaaaccgctagattttgaagcggcgattgagattcttcgccgtgacggcagt
gcgcttgcgagcctggatgaaacggtcattttaaatttgaagaatacgtatgtaaattct
gtcggcattttaggttcctataagccgaaaaccttccgcggaaatgttttgtttttcaga
tcaacaatcattcctgaatggtttgacccgattgaacctgactcgtggaagccttatatt
aacggacagattgaacaaatcgacatcgactgccgtcataaagatttatgtcagcctgaa
cctctggctcaaatcggcaaggttctcgctgtcaaattggaagagttgaataaataa

DBGET integrated database retrieval system