KEGG   Bacillus subtilis subsp. subtilis 168: BSU31960
Entry
BSU31960          CDS       T00010                                 

Gene name
dhbF
Definition
(RefSeq) dimodular nonribosomal peptide synthase
  KO
K04780  glyine---[glycyl-carrier protein] ligase [EC:6.2.1.66]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01053  Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BSU31960 (dhbF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU31960 (dhbF)
Enzymes [BR:bsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.66  glyine---[glycyl-carrier protein] ligase
     BSU31960 (dhbF)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Bacillibactin synthetase
    BSU31960 (dhbF)
SSDB
Motif
Pfam: AMP-binding Condensation AMP-binding_C PP-binding Thioesterase Abhydrolase_6 Abhydrolase_1 Hydrolase_4 HicB
Other DBs
NCBI-GeneID: 936569
NCBI-ProteinID: NP_391076
Pasteur: BG11243
BSORF: BG11243
UniProt: P45745 A0A6M3ZFN1
Position
complement(3280519..3287655)
AA seq 2378 aa
MPDTKDLQYSLTGAQTGIWFAQQLDPDNPIYNTAEYIEINGPVNIALFEEALRHVIKEAE
SLHVRFGENMDGPWQMINPSPDVQLHVIDVSSEPDPEKTALNWMKADLAKPVDLGYAPLF
NEALFIAGPDRFFWYQRIHHIAIDGFGFSLIAQRVASTYTALIKGQTAKSRSFGSLQAIL
EEDTDYRGSEQYEKDRQFWLDRFADAPEVVSLADRAPRTSNSFLRHTAYLPPSDVNALKE
AARYFSGSWHEVMIAVSAVYVHRMTGSEDVVLGLPMMGRIGSASLNVPAMVMNLLPLRLT
VSSSMSFSELIQQISREIRSIRRHHKYRHEELRRDLKLIGENHRLFGPQINLMPFDYGLD
FAGVRGTTHNLSAGPVDDLSINVYDRTDGSGLRIDVDANPEVYSESDIKLHQQRILQLLQ
TASAGEDMLIGQMELLLPEEKEKVISKWNETAKSEKLVSLQDMFEKQAVLTPERIALMCD
DIQVNYRKLNEEANRLARLLIEKGIGPEQFVALALPRSPEMVASMLGVLKTGAAYLPLDP
EFPADRISYMLEDAKPSCIITTEEIAASLPDDLAVPELVLDQAVTQEIIKRYSPENQDVS
VSLDHPAYIIYTSGSTGRPKGVVVTQKSLSNFLLSMQEAFSLGEEDRLLAVTTVAFDISA
LELYLPLISGAQIVIAKKETIREPQALAQMIENFDINIMQATPTLWHALVTSEPEKLRGL
RVLVGGEALPSGLLQELQDLHCSVTNLYGPTETTIWSAAAFLEEGLKGVPPIGKPIWNTQ
VYVLDNGLQPVPPGVVGELYIAGTGLARGYFHRPDLTAERFVADPYGPPGTRMYRTGDQA
RWRADGSLDYIGRADHQIKIRGFRIELGEIDAVLANHPHIEQAAVVVREDQPGDKRLAAY
VVADAAIDTAELRRYMGASLPDYMVPSAFVEMDELPLTPNGKLDRKALPAPDFSTSVSDR
APRTPQEEILCDLFAEVLGLARVGIDDSFFELGGHSLLAARLMSRIREVMGAELGIAKLF
DEPTVAGLAAHLDLAQSACPALQRAERPEKIPLSFAQRRLWFLHCLEGPSPTYNIPVAVR
LSGELDQGLLKAALYDLVCRHESLRTIFPESQGTSYQHILDADRACPELHVTEIAEKELS
DRLAEAVRYSFDLAAEPAFRAELFVIGPDEYVLLLLVHHIVGDGWSLTPLTRDLGTAYAA
RCHGRSPEWAPLAVQYADYALWQQELLGNEDDPNSLIAGQLAFWKETLKNLPDQLELPTD
YSRPAEPSHDGDTIHFRIEPEFHKRLQELARANRVSLFMVLQSGLAALLTRLGAGTDIPI
GSPIAGRNDDALGDLVGLFINTLVLRTDTSGDPSFRELLDRVREVNLAAYDNQDLPFERL
VEVLNPARSRATHPLFQIMLAFQNTPDAELHLPDMESSLRINSVGSAKFDLTLEISEDRL
ADGTPNGMEGLLEYSTDLFKRETAQALADRLMRLLEAAESDPDEQIGNLDILAPEEHSSM
VTDWQSVSEKIPHACLPEQFEKQAALRPDAIAVVYENQELSYAELNERANRLARMMISEG
VGPEQFVALALPRSLEMAVGLLAVLKAGAAYLPLDPDYPADRIAFMLKDAQPAFIMTNTK
AANHIPPVENVPKIVLDDPELAEKLNTYPAGNPKNKDRTQPLSPLNTAYVIYTSGSTGVP
KGVMIPHQNVTRLFAATEHWFRFSSGDIWTMFHSYAFDFSVWEIWGPLLHGGRLVIVPHH
VSRSPEAFLRLLVKEGVTVLNQTPSAFYQFMQAEREQPDLGQALSLRYVIFGGEALELSR
LEDWYNRHPENRPQLINMYGITETTVHVSYIELDRSMAALRANSLIGCGIPDLGVYVLDE
RLQPVPPGVAGELYVSGAGLARGYLGRPGLTSERFIADPFGPPGTRMYRTGDVARLRADG
SLDYVGRADHQVKIRGFRIELGEIEAALVQHPQLEDAAVIVREDQPGDKRLAAYVIPSEE
TFDTAELRRYAAERLPDYMVPAAFVTMKELPLTPNGKLDRKALPAPDFAAAVTGRGPRTP
QEEILCDLFMEVLHLPRVGIDDRFFDLGGHSLLAVQLMSRIREALGVELSIGNLFEAPTV
AGLAERLEMGSSQSALDVLLPLRTSGDKPPLFCVHPAGGLSWCYAGLMTNIGTDYPIYGL
QARGIGQREELPKTLDDMAADYIKQIRTVQPKGPYHLLGWSLGGNVVQAMATQLQNQGEE
VSLLVMLDAYPNHFLPIKEAPDDEEALIALLALGGYDPDSLGEKPLDFEAAIEILRRDGS
ALASLDETVILNLKNTYVNSVGILGSYKPKTFRGNVLFFRSTIIPEWFDPIEPDSWKPYI
NGQIEQIDIDCRHKDLCQPEPLAQIGKVLAVKLEELNK
NT seq 7137 nt   +upstreamnt  +downstreamnt
atgcctgatacaaaagatcttcaatattctttgaccggggcgcaaactggcatatggttt
gctcagcagcttgatccggacaatccaatctacaatacagcggaatatatagaaatcaat
ggaccagtcaatattgctctttttgaagaagctttgcggcacgtgatcaaggaagcggaa
tcgctgcatgtccgcttcggtgaaaatatggacgggccttggcagatgataaacccgtct
ccggatgtacagctgcacgtcattgacgtcagctctgagcctgatccggaaaaaacagca
ttaaactggatgaaagctgatttagcaaagccggttgatttagggtatgcccctttgttc
aatgaagctctgtttattgccgggcctgatcgtttcttttggtatcagcgcattcaccat
atagcgatcgacggcttcggtttttccctgatagcccagcgtgtggcaagtacatatact
gcccttataaaaggacaaacagctaaaagccgttcctttgggtctctccaggccattttg
gaggaggatacagattatcgcggatcagagcagtatgagaaggatcgtcaattctggctg
gaccgttttgcagatgcacctgaagttgtgagcttggctgatcgggcgccaagaacatct
aacagttttcttcgtcatacggcatatctgcctccgtctgatgtaaacgcgttaaaagaa
gcggcgcgctatttctcaggaagctggcatgaagtcatgattgcggtgtcagctgtttat
gtgcaccgtatgaccggctctgaggatgttgtgctcggcctgcccatgatgggtcggata
gggtccgcgtcactgaatgtaccggctatggtgatgaaccttctcccgctccggctgacg
gtaagctcttcgatgagcttttctgaactgattcagcaaatttcccgggaaatccgcagt
attcggcgacatcataagtatcgccatgaagagcttaggcgcgatctgaaattgatagga
gaaaatcatagattatttggccctcaaatcaatcttatgccgtttgattacggtctcgac
tttgccggcgtccggggcacaacgcataatctttcagccggtcctgttgatgatctatca
atcaatgtatatgacagaacagacggcagcgggctgcgaattgatgttgatgcgaatccc
gaggtatacagtgagtctgatattaagcttcatcagcagcgtattttgcagctgctgcaa
acggcttctgccggagaggacatgctgattgggcaaatggagcttctgttgccagaggag
aaagaaaaagtcatttctaaatggaatgagacggcaaaatccgagaagctggtcagcctt
caggacatgttcgaaaagcaggcagttcttacgccagaacgtatcgctctcatgtgtgat
gacattcaagtcaactatcgaaagctcaatgaagaggcaaaccgcctcgcgcgtctgttg
atcgaaaaagggattggtccggagcaatttgtcgctttggcgctgccgcgttcccctgag
atggtggcttcaatgcttggtgtgctcaagactggtgcggcgtatctcccccttgatccg
gagtttccagccgaccgcatttcttacatgctggaggatgcgaaaccttcatgcatcata
acgactgaggaaatagcagccagtctgcctgatgacctggctgtacctgagcttgtgctt
gatcaggctgttacacaggagattataaaacgctattcgccggaaaatcaggatgtatcg
gtttcgcttgaccatcctgcgtatatcatctatacctcaggatcaacaggaagaccgaag
ggagtcgttgtgacacagaaaagcttaagcaattttctgctgtctatgcaggaggcattt
tctctaggagaagaagacaggctgttggctgtgacgactgtcgcttttgatatttcagca
ttggagttatatcttccgctgattagcggagcgcaaatcgtgatcgcaaagaaagaaacg
atccgtgagccgcaggcattagctcaaatgattgaaaatttcgatattaacattatgcag
gcgacaccgacactgtggcacgctttggtaacgagtgaacctgagaaacttcgggggctt
agagtgcttgtaggaggcgaggcgctgccgagcggtcttttgcaggaacttcaagacctt
cattgttcagtcacgaacttatacggtcccactgaaacaacgatttggtctgccgcagct
tttcttgaagaagggctgaagggcgttcctccgattgggaaaccgatttggaacacgcag
gtgtatgtgcttgataatggattgcagccggtgccgccgggcgttgtcggagagctttat
attgcaggaaccggcttggccagaggttatttccatcgtcctgatttaacggcggagcgc
ttcgttgcagatccatacggaccgccgggaactcggatgtatcggaccggagaccaggcc
cgctggcgcgccgatgggtctttggattatatcgggcgggcggatcatcaaatcaaaatt
cgcggattccgaattgaacttggagaaattgatgccgtgcttgccaatcacccgcacatt
gaacaggccgcggttgtcgtacgggaagatcagccgggagacaaacgattggcggcttat
gtagtcgctgatgctgctattgatactgcagagcttcgtcgttatatgggggctagtctt
cctgattatatggtaccgtcggcgtttgtggagatggacgagctgccgttaacacctaat
ggcaagcttgaccggaaagcactgccggcaccagacttcagcacatctgtcagtgatcgg
gccccgcggactcctcaggaagagatattgtgtgacttgtttgcagaggttctcggtttg
gcacgcgtcggtatcgatgacagtttcttcgagcttgggggccattctcttcttgcagcc
cgtctgatgagccgcattcgcgaggtaatgggagccgaacttggtatcgccaagctcttt
gacgaaccgacagtagccggactcgctgcccatcttgatttggcgcagagtgcatgtccc
gctttgcagagagctgagcggcctgaaaagatcccgctctcatttgcccagcgccggcta
tggttcctgcattgtctggaaggaccgagtcctacttataatattccggttgctgtccgt
ttgtcaggtgagttggatcaaggattgctgaaagcggcactttatgacctcgtctgccgt
catgaaagtcttcggacgatcttccctgaatcacaggggacatcctatcagcatatttta
gatgccgatcgagcctgtcccgagttacatgttactgaaattgctgagaaggagctttct
gatcggcttgccgaagctgtacgctacagctttgatcttgcagctgaacctgcttttcgt
gccgagctttttgtgatcggtcctgacgagtacgtgctgcttcttctcgtccatcatatt
gtcggggacggctggtccttaacaccgctgaccagagaccttgggacagcttatgcggct
cgctgccacggacgatctcccgaatgggcgcctcttgctgtgcagtatgcagactatgcg
ctttggcagcaagaactgcttggaaacgaggatgatccaaatagcttgattgccggacag
cttgctttctggaaagaaaccttgaaaaacctgcctgatcagcttgaactgccaaccgat
tattcacgtccggctgagccgagtcatgatggagatacgattcattttcgtattgagccc
gagtttcacaagcgattgcaggagctggctcgcgcaaatagggtgagcctgtttatggtg
cttcaatccggtctcgccgctttattgacaaggctcggggcgggcaccgacattccgatc
ggcagtccgatcgcgggacggaatgatgatgcgctgggcgatcttgtagggctgttcatt
aatacattggtgctcagaactgatacgtccggtgacccaagctttcgtgagcttctagac
agagtacgggaagtgaatctggccgcctatgacaatcaggatctgccgtttgagagactt
gtagaggtgctcaatccggctcgttcgcgtgcgacgcatcctttattccaaatcatgctt
gcgttccaaaacacaccggacgctgaactgcatcttcctgatatggagagcagcctgcga
atcaacagtgtcggttctgccaagtttgatttgacgctggaaattagtgaagatcgcctt
gctgacgggacaccaaacggaatggaaggactgcttgaatacagcactgatcttttcaaa
cgggaaactgctcaggctcttgctgaccgattgatgcgcctgttggaggctgccgagtct
gatcctgacgagcaaatcggaaatctggatattcttgcgccagaggaacacagcagcatg
gtgactgattggcaaagtgtatctgaaaagattccgcacgcatgtttgccagagcaattt
gagaagcaggctgctttacgtcctgatgccattgccgttgtatatgaaaatcaggaactg
agctatgcagagctgaatgaaagagcaaaccggcttgcccgaatgatgattagtgaaggt
gtcgggccggagcaatttgtggcattggcactgccccgatcgttggaaatggctgtcggc
ctattggcggtgctaaaggccggggcagcttatctccctcttgatccggattatccggct
gatcgaattgcttttatgctaaaagatgcacagcctgcgtttatcatgacgaacactaaa
gctgcaaatcacattccgccagttgaaaacgtgccgaaaatcgtgctggatgatcccgag
ctggcagagaaactaaacacgtaccctgcaggtaatccaaaaaataaggataggactcag
ccgctttcccctttgaatacggcatatgtcatttatacatccggctcaacaggtgttcca
aaaggtgtgatgattcctcaccaaaatgtaacacgtttatttgcagcgaccgagcactgg
ttccgtttcagctcaggtgatatctggaccatgttccattcctatgcgtttgatttttcg
gtgtgggagatctggggtcctctgctgcatggcggacgtcttgtaatcgtgcctcaccac
gtcagcagatcgccagaagcgtttctgcgcctgcttgtcaaagagggggtgactgttctg
aaccagacaccgtctgctttctatcagtttatgcaggcggaacgggaacagccggatctc
ggacaggcactcagtctgcgctatgtcatttttggcggagaagcgcttgaactcagccgt
ttagaggattggtacaaccgccaccctgaaaatagaccgcagcttatcaatatgtatggt
attacagaaacgacggtgcatgtgagctatatcgaattagaccgaagcatggcagcttta
cgggcaaacagcttgatcggctgcggcattcccgatcttggtgtatacgtgctggatgaa
cgcctgcagccggtcccgccgggtgttgccggagagctgtatgtatcaggagcggggtta
gcacgaggttatctaggccggcctggtttaacatctgaacgcttcatagctgatccgttc
ggtcctccaggcacccggatgtaccgcactggggatgtggcccgcctccgcgctgacggt
tctctcgactatgtcggccgtgcagaccatcaagtgaaaattcggggattccggattgaa
ttgggagaaattgaagccgcgcttgttcagcatccgcagcttgaagatgcggcagtgatc
gttcgtgaggatcagccgggagataaacggttagcagcttatgtcatcccttcggaagaa
acatttgatacggcggaactgcgcagatatgctgctgagagactgccggattacatggtg
cctgctgcctttgtgacgatgaaagaattgccgctgacaccgaatggaaagcttgatcgt
aaagcgctgcccgctccggatttcgcagcggcagtgacaggacgaggaccgagaacgccg
caggaagaaattctctgtgacctctttatggaggtgcttcacttgccgcgtgtcggcatt
gatgaccgtttctttgatttaggcggacattccttgcttgctgtacagctcatgagccgc
attcgtgaagcgctcggcgttgaactcagcatcggcaacttgttcgaagcacctactgta
gccgggctcgctgaaagacttgaaatgggatcaagccaaagcgctcttgacgttctgctg
ccgctccgaacaagcggagacaagcctcctttattctgtgttcatccggcaggggggctc
agctggtgttatgccggtttgatgaccaatataggaacagattatccgatctacggcttg
caggcacggggaatcgggcagcgcgaggagcttccgaaaacacttgatgacatggctgcc
gattacattaaacaaatccgaacggtccagccaaaaggcccgtaccatctgctgggctgg
tccctgggcgggaatgtcgttcaagcgatggctacccagctgcaaaatcaaggagaagaa
gtatccctgttggtgatgctggacgcctatccgaaccacttccttcctataaaagaggca
ccggatgatgaggaagcgcttattgcccttctggcgttaggcgggtatgatccagacagc
ttaggggaaaaaccgctagattttgaagcggcgattgagattcttcgccgtgacggcagt
gcgcttgcgagcctggatgaaacggtcattttaaatttgaagaatacgtatgtaaattct
gtcggcattttaggttcctataagccgaaaaccttccgcggaaatgttttgtttttcaga
tcaacaatcattcctgaatggtttgacccgattgaacctgactcgtggaagccttatatt
aacggacagattgaacaaatcgacatcgactgccgtcataaagatttatgtcagcctgaa
cctctggctcaaatcggcaaggttctcgctgtcaaattggaagagttgaataaataa

DBGET integrated database retrieval system