KEGG   Bacillus subtilis subsp. subtilis 168: BSU32090Help
Entry
BSU32090          CDS       T00010                                 

Gene name
yuiA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5351 DnaJ_CXXCXGXG Anti-TRAP DUF2318 zf-nanos Zn_Tnp_IS1595 DUF1356
Motif
Other DBs
NCBI-GeneID: 938869
NCBI-ProteinID: NP_391089
Pasteur: BG12389
BSORF: BG12389
UniProt: O32110
Position
complement(3299718..3299861)
Genome map
AA seq 47 aa AA seqDB search
MKTATTTASHACPFCSGKGYFQLILGGSETCPSCQGTGKDSHSFSSR
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgcaacgacaaccgcttcacatgcatgcccattttgttcagggaaaggatat
tttcaattgattctcggcggttcagagacttgtccgtcttgccaggggacaggaaaagac
agtcattctttttccagccgttga

DBGET integrated database retrieval system