KEGG   Bacillus subtilis subsp. subtilis 168: BSU32090
Entry
BSU32090          CDS       T00010                                 

Symbol
yuiA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5351 DnaJ_CXXCXGXG Anti-TRAP FtrD-like DUF1356
Other DBs
NCBI-GeneID: 938869
NCBI-ProteinID: NP_391089
Pasteur: BG12389
BSORF: BG12389
UniProt: O32110 A0A6M3ZGA2
Position
complement(3299718..3299861)
AA seq 47 aa
MKTATTTASHACPFCSGKGYFQLILGGSETCPSCQGTGKDSHSFSSR
NT seq 144 nt   +upstreamnt  +downstreamnt
atgaaaactgcaacgacaaccgcttcacatgcatgcccattttgttcagggaaaggatat
tttcaattgattctcggcggttcagagacttgtccgtcttgccaggggacaggaaaagac
agtcattctttttccagccgttga

DBGET integrated database retrieval system