KEGG   Bacillus subtilis subsp. subtilis 168: BSU32130Help
Entry
BSU32130          CDS       T00010                                 

Gene name
guaC
Definition
(RefSeq) GMP reductase
  KO
K00364  GMP reductase [EC:1.7.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32130 (guaC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.7  GMP reductase
     BSU32130 (guaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH FMN_dh NMO His_biosynth TMP-TENI ThiG DHO_dh Aldolase Glu_synthase
Motif
Other DBs
NCBI-GeneID: 937189
NCBI-ProteinID: NP_391093
Pasteur: BG12392
BSORF: BG12392
UniProt: O05269
Position
3303042..3304022
Genome map
AA seq 326 aa AA seqDB search
MENVFDYEDIQLIPAKCIVNSRSECDTSVRLGGHTFKLPVVPANMQTIIDEKLAISLAEN
GYFYVMHRFEPETRIDFIKDMNARGLFSSISVGVKDEEYEFVRQLAEENLTPEYVTIDIA
HGHSNAVIEMIQHLKKHLPDSFVIAGNVGTPEAVRELENAGADATKVGIGPGKVCITKIK
TGFGTGGWQLAALRWCAKAASKPIIADGGIRTHGDIAKSIRFGATMVMIGSLFAGHEESP
GQTIEKDGKLYKEYFGSASEFQKGEKKNVEGKKMHVAHKGSIKDTLIEMEQDLQSSISYA
GGTKLNAIRNVDYVIVKNSIFNGDKY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtatttgattacgaagatattcagctaattcctgcaaaatgcattgtgaat
agccgttcagaatgtgatacatccgtacgtttaggcggacatacatttaaattgcccgtc
gtccctgccaatatgcagacgattatagatgaaaaactagcgatttcattagccgaaaat
ggctacttttatgtgatgcaccgatttgagcctgagacacgaattgattttattaaagat
atgaacgcacgcgggttattctcttctatcagcgtgggcgtcaaagatgaggagtatgaa
tttgtccgccagctggcagaagaaaatctgactcctgaatacgtgacaattgacattgct
cacgggcactcaaatgctgtcattgaaatgatccagcaccttaaaaaacatttgccggac
agctttgttattgctggcaatgtcggaacgccggaagcggtcagagagcttgaaaatgcg
ggagcggatgccactaaagtcggcatcggaccgggaaaagtatgtattacgaaaatcaaa
acaggcttcggcacaggcggctggcaattagcagcgctgcgctggtgtgccaaggctgcc
agcaaaccgattatcgcggatggcggcatccgcacccatggcgacatcgcaaaatcaatc
cgattcggcgcaacgatggtcatgatcggttcactatttgccggacacgaagaatcgcca
ggccaaacgatcgaaaaagacggaaagctttacaaggagtacttcggctcagcctctgaa
ttccaaaaaggcgaaaagaaaaatgtcgaaggcaaaaaaatgcacgtggcgcataaaggc
tcaatcaaggatacactgattgaaatggagcaggatcttcaatcttctatttcttatgca
ggcggaacaaagcttaacgccatccgcaatgtggattatgtgattgtgaagaattccatt
tttaatggggataaatattaa

DBGET integrated database retrieval system