KEGG   Bacillus subtilis subsp. subtilis 168: BSU32230Help
Entry
BSU32230          CDS       T00010                                 

Gene name
yuxL
Definition
(RefSeq) peptidase YuxL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S9 PD40 DPPIV_N Peptidase_S15 DLH Gmad1 AXE1 Abhydrolase_1 Hydrolase_4 COesterase Abhydrolase_3 PhoPQ_related BAAT_C FSH1 DUF2920 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 936648
NCBI-ProteinID: NP_391103
Pasteur: BG10463
BSORF: BG10463
UniProt: P39839
Position
complement(3310763..3312736)
Genome map
AA seq 657 aa AA seqDB search
MKKLITADDITAIVSVTDPQYAPDGTRAAYVKSQVNQEKDSYTSNIWIYETKTGGSVPWT
HGEKRSTDPRWSPDGRTLAFISDREGDAAQLYIMSTEGGEARKLTDIPYGVSKPLWSPDG
ESILVTVSLGEGESIDDREKTEQDSYEPVEVQGLSYKRDGKGLTRGAYAQLVLVSVKSGE
MKELTSHKADHGDPAFSPDGKWLVFSANLTETDDASKPHDVYIMSLESGDLKQVTPHRGS
FGSSSFSPDGRYLALLGNEKEYKNATLSKAWLYDIEQGRLTCLTEMLDVHLADALIGDSL
IGGAEQRPIWTKDSQGFYVIGTDQGSTGIYYISIEGLVYPIRLEKEYINSFSLSPDEQHF
IASVTKPDRPSELYSIPLGQEEKQLTGANDKFVREHTISIPEEIQYATEDGVMVNGWLMR
PAQMEGETTYPLILNIHGGPHMMYGHTYFHEFQVLAAKGYAVVYINPRGSHGYGQEFVNA
VRGDYGGKDYDDVMQAVDEAIKRDPHIDPKRLGVTGGSYGGFMTNWIVGQTNRFKAAVTQ
RSISNWISFHGVSDIGYFFTDWQLEHDMFEDTEKLWDRSPLKYAANVETPLLILHGERDD
RCPIEQAEQLFIALKKMGKETKLVRFPNASHNLSRTGHPRQRIKRLNYISSWFDQHL
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgataaccgcagacgacatcacagcgattgtctctgtgaccgatcctcaa
tacgccccagacggtacccgtgccgcatatgtaaaatcacaagtaaatcaagagaaagat
tcgtatacatcaaatatatggatctatgaaacgaaaacgggaggatctgttccttggaca
catggagaaaagcgaagcaccgacccaagatggtctccggacgggcgcacgcttgccttt
atttctgatcgagaaggcgatgcggcacagctttatatcatgagcactgaaggcggagaa
gcaagaaaactgactgatatcccatatggcgtgtcaaagccgctatggtccccggacggt
gaatcgattctggtcactgtcagtttgggagagggggaaagcattgatgaccgagaaaaa
acagagcaggacagctatgaacctgttgaagtgcaaggcctctcctacaaacgggacggc
aaagggctgacgagaggtgcgtatgcccagcttgtgcttgtcagcgtaaagtcgggtgag
atgaaagagctgacaagtcacaaagctgatcatggtgatcctgctttttctcctgacggc
aaatggcttgttttctcagctaatttaactgaaacagatgatgccagcaagccgcatgat
gtttacataatgtcactggagtctggagatcttaagcaggttacacctcatcgcggctca
ttcggatcaagctcattttcaccagacggaaggtatcttgctttgcttggaaatgaaaag
gaatataagaatgctacgctctcaaaggcgtggctctatgatatcgaacaaggccgcctc
acatgtcttactgagatgctggacgttcatttagcggatgcgctgattggagattcattg
atcggtggtgctgaacagcgcccgatttggacaaaggacagccaagggttttatgtcatc
ggcacagatcaaggcagtacgggcatctattatatttcgattgaaggccttgtgtatccg
attcgtctggaaaaagagtacatcaatagcttttctctttcacctgatgaacagcacttt
attgccagtgtgacaaagccggacagaccgagtgagctttacagtatcccgcttggacag
gaagagaaacagctgactggcgcgaatgacaagtttgtcagggagcatacgatatcaata
cctgaagagattcaatatgctacagaagacggcgtgatggtgaacggctggctgatgagg
cctgcacaaatggaaggtgagacaacatatccacttattcttaacatacacggcggtccg
catatgatgtacggacatacatattttcatgagtttcaggtgctggcggcgaaaggatac
gcggtcgtttatatcaatccgagaggaagccacggctacgggcaggaatttgtgaatgcg
gtcagaggagattatgggggaaaggattatgacgatgtgatgcaggctgtggatgaggct
atcaaacgagatccgcatattgatcctaagcggctcggtgtcacgggcggaagctacgga
ggttttatgaccaactggatcgtcgggcagacgaaccgctttaaagctgccgttacccag
cgctcgatatcaaattggatcagctttcacggcgtcagtgatatcggctatttctttaca
gactggcagcttgagcatgacatgtttgaggacacagaaaagctctgggaccggtctcct
ttaaaatacgcagcaaacgtggagacaccgcttttgatactgcatggcgagcgggatgac
cgatgcccgatcgagcaggcggagcagctgtttatcgctctgaaaaaaatgggcaaggaa
accaagcttgtccgttttccgaatgcatcgcacaatttatcacgcaccggacacccaaga
cagcggatcaagcgcctgaattatatcagctcatggtttgatcaacatctctaa

DBGET integrated database retrieval system