KEGG   Bacillus subtilis subsp. subtilis 168: BSU32410Help
Entry
BSU32410          CDS       T00010                                 

Gene name
pucH
Definition
(RefSeq) allantoinase
  KO
K01466  allantoinase [EC:3.5.2.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32410 (pucH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.5  allantoinase
     BSU32410 (pucH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Urease_alpha AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 936662
NCBI-ProteinID: NP_391121
Pasteur: BG13982
BSORF: BG13982
UniProt: O32137
Position
complement(3327247..3328587)
Genome map
AA seq 446 aa AA seqDB search
MAYDMVIKGAKAVTPDGVIEADIVVQNGVIAEIGSDIEASGTEIIQADGKYVFPGVIDCH
VHFNEPGREDWEGFETGSQMMAAGGCTTYFDMPLNCIPSTVTAEHLLAKAELGRQKSAVD
FALWGGLVPGHIEDIRPMAEAGAIGFKAFLSKSGTDEFRSVDERTLLKGMAEIAAAGKIL
ALHAESDAITSYLQMVLANKGKVDADAYAASRPEEAEVEAVYRTIQYAKVTGCPVHFVHI
STAKAVRLIREAKQEGLDVSVETCPHYVLFSHDDLRQRGSVAKCAPPLRSRQSKETLIET
LIAGDIDMVSSDHSPCRPSLKREDNMFLSWGGISGGQFTLLGMLELALEHQIPFETIAEW
TAAAPAKRFGLQKKGRLEAGCDADFVLVSMEPYTVTRESMFAKHKKSIYEGHTFPCSISA
TYSKGRCVYNDGEKVTEIDGALVVPS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgatatggtgataaaaggtgcgaaggcagttacgccagatggcgttatagaa
gctgatattgtagttcaaaacggtgtcattgccgagataggttctgacattgaagcaagc
gggacggaaatcatccaggcagacgggaaatacgtgtttcctggtgtgatagattgccat
gttcattttaatgaaccgggcagggaggattgggaggggtttgaaacaggttctcaaatg
atggccgcaggcggttgcactacctattttgatatgccgctcaactgtattccatcaacc
gtgacggcagagcatcttctcgcaaaagctgagctaggcaggcaaaaatctgccgtggat
tttgcgctatggggcggccttgtgccaggccatatcgaggacatccgtccgatggctgaa
gcgggagcgatcgggtttaaagcgtttttatcaaagtcaggcactgatgagttccgctct
gttgatgaacggacattgctcaaaggcatggcagaaatcgcggctgcaggaaaaatcctc
gctctccacgcggaaagcgacgcgatcacaagctacttgcagatggttttggccaataaa
ggaaaggtggatgcggatgcgtacgccgcctcccgcccggaggaagcagaagttgaagcg
gtgtatcgcacgattcagtatgcgaaggtgacaggctgtccggttcattttgtccatatc
agcacggcgaaagcggtccggctgatcagagaggcgaaacaggaaggtcttgatgtttcg
gttgaaacatgtccgcattatgtcttgttcagccatgacgatttacggcaaaggggctct
gtcgcaaaatgcgcgcctccgctccggtcacggcaatcaaaagagacgctgatcgagacg
ctcattgccggggacattgacatggtttcctcagaccattccccttgccgtccatccttg
aagcgggaggataacatgtttttatcatggggcggaatcagcggcgggcagttcacttta
ttaggaatgctggaactggcgcttgagcatcagattccatttgaaaccatcgcagaatgg
acagcggcggcccctgcaaaacgattcggccttcagaaaaaagggcggcttgaggcgggg
tgtgatgcagatttcgtgctcgtcagcatggagccgtacactgttacaagagaatcgatg
tttgcaaagcataaaaaaagcatttacgaaggacatacatttccctgcagcatttcggcc
acttacagcaaaggccggtgcgtgtacaatgatggggaaaaagtcactgaaattgacgga
gctctggtcgttccttcgtaa

DBGET integrated database retrieval system