KEGG   Bacillus subtilis subsp. subtilis 168: BSU32490Help
Entry
BSU32490          CDS       T00010                                 

Gene name
pucC
Definition
(RefSeq) xanthine dehydrogenase subunit C
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32490 (pucC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BSU32490 (pucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_5 CO_deh_flav_C
Motif
Other DBs
NCBI-GeneID: 936685
NCBI-ProteinID: NP_391129
Pasteur: BG13990
BSORF: BG13990
UniProt: O32145
Position
complement(3338501..3339334)
Genome map
AA seq 277 aa AA seqDB search
MNGQVTKARMNIQLWRPAALDEAYSLLEKLAPDVCAASGSTLLQLQWDKGTLPKQHLVSL
EGIDEMRGISTSDTHVSIGGLTSLNECRKNPLIKRALSCFSDAASAVAAPGIRSRATIGG
NIASKIGDFIPLLLVLGAELIVYQKELIRLPLGAWLSEEDFRTAIVTRVIIPRAEGERVF
YHKLGRRQAFTGAAAVAAGRFLKDGSIRLAAGHADITPRRLLDSEAKWMAPGWDPHELYK
TLIHELPFSSDVFMSAAYRKKAAANVIMAELMAEGGE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggccaagtgacaaaagcaaggatgaatattcaattatggagaccggcagcgctt
gatgaggcctattcgcttttagagaagcttgctccggatgtgtgtgccgcatcgggaagc
acgctccttcagcttcagtgggacaaaggaactctaccgaaacagcaccttgtcagcctt
gaagggattgacgaaatgcgagggatcagcaccagtgacacccacgtgtcgatcgggggg
ctcacatcactgaatgaatgcagaaagaaccctttgattaagagagcgcttagctgtttc
agtgacgctgcttccgctgtcgctgcaccggggattcgcagccgtgccacgattggcggc
aacatagcgagtaaaatcggtgatttcattccgcttctgcttgtgcttggtgctgagctt
atcgtatatcaaaaggagctaatcaggctgccgcttggcgcttggctcagtgaggaagac
tttagaacggctatcgtcacgcgtgtcatcatcccgcgggcggagggagagcgtgtattt
tatcacaagcttggaaggcgccaggcttttaccggagcggctgctgttgcagctggacgt
tttttgaaagacggcagcattcgcctcgccgctggccatgccgatatcactcctaggaga
ttattggacagcgaagcgaaatggatggcaccagggtgggacccgcatgagctgtacaaa
acacttatccatgagctgccgttttcctcagatgtttttatgtcagcggcatacagaaaa
aaagccgctgccaacgtcatcatggcagagctgatggctgagggaggggaataa

DBGET integrated database retrieval system