KEGG   Bacillus subtilis subsp. subtilis 168: BSU32780
Entry
BSU32780          CDS       T00010                                 

Gene name
yusF
Definition
(RefSeq) hypothetical protein
  KO
K07476  toprim domain protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BSU32780 (yusF)
SSDB
Motif
Pfam: Toprim Toprim_2 Toprim_4 Tk-SP_N-pro YqeC
Other DBs
NCBI-GeneID: 936707
NCBI-ProteinID: NP_391157
Pasteur: BG14018
BSORF: BG14018
UniProt: O32172
Position
complement(3365391..3365831)
AA seq 146 aa
MLAVNFTAFFYNLNISNLTRQVNKMKMDELEKVMIVEGKSDKEKIESVLNEPMRIICTNG
TISQLRLEELADELYDKDVYILVDADESGEKLRKQLKREFNEACHLHVDRAYKEVAAAPR
HHIASVLLRANLNVHTIFLERKSRGV
NT seq 441 nt   +upstreamnt  +downstreamnt
atgttggcggtgaatttcactgccttcttttacaatctgaacatttcaaatttgacgcgg
caggtgaacaagatgaagatggatgagctggaaaaggttatgattgtcgaggggaaatca
gataaagagaaaatcgaaagcgtcctgaatgaaccgatgcgcattatctgcacaaacgga
acaatcagccagctgaggctcgaggaattggctgacgagctttatgataaagacgtctat
atattagttgatgctgatgaatcaggtgagaaattgagaaaacagctgaagcgtgaattt
aatgaagcctgccatctccatgtcgacagagcctataaggaagtagcggctgcgcccagg
caccatatcgcttctgtattgctgcgtgcgaatctgaatgtccatactatttttcttgaa
agaaagtcccgaggtgtatag

DBGET integrated database retrieval system