KEGG   Bacillus subtilis subsp. subtilis 168: BSU32850Help
Entry
BSU32850          CDS       T00010                                 

Gene name
fadM
Definition
(RefSeq) proline dehydrogenase 1
  KO
K00318  proline dehydrogenase [EC:1.5.5.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU32850 (fadM)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BSU32850 (fadM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_dh DNA_pol3_tau_5
Motif
Other DBs
NCBI-GeneID: 937064
NCBI-ProteinID: NP_391164
Pasteur: BG14025
BSORF: BG14025
UniProt: O32179
Position
complement(3372740..3373648)
Genome map
AA seq 302 aa AA seqDB search
MLRHVFLFLSQNKTLTKFAKAYGTRLGARRFVAGDTIESAVKTVKRLNRSGLCATIDYLG
EYAASEKEANQVAEECKKAIQAIAEHQLNSELSLKLTSIGLDLSEELALTHLRAILSVAK
QYDVAVTIDMEDYSHYEQTLSIYRQCKQEFEKLGTVIQAYLYRAAEDIRKMRDLKPNLRL
VKGAYKESAAVAFPDKRGTDLHFQSLIKLQLLSGNYTAVATHDDDIIAFTKQLVAEHQIP
ASQFEFQMLYGIRPERQKELAKEGYRMRVYVPYGTDWFSYFMRRIAERPANAAFVLKGIL
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgttgagacatgtgtttttattcttatctcaaaataaaacacttaccaagttcgcaaaa
gcatacggaacgcggcttggagcacgaaggtttgtcgcaggggatacgattgaatcggcg
gttaagaccgtcaaaaggctaaacagatccggtttgtgtgcaacaattgattatttaggc
gagtatgcagcttcggaaaaagaagcaaaccaagtcgcagaggaatgcaagaaagccatt
caagccattgccgaacatcaattgaattcagagctttcacttaagctgacctcaatcggg
ctcgatctttcagaagaacttgctcttactcatttgcgcgccattctttccgttgcgaag
caatatgatgttgctgtgaccattgatatggaagactattctcattatgaacagacactt
tctatttacaggcaatgcaaacaggaatttgagaagctcggcacggtcattcaggcgtat
ttgtaccgggcggcagaagatatcagaaagatgcgggacttaaagccgaatctcagactt
gtaaaaggcgcttataaagaatctgcggctgtagcgtttcccgacaaaagaggcacggac
cttcattttcagagcttaataaagctgcagttgttaagcgggaactacacggctgtcgcc
acacatgacgatgacatcattgcatttacgaaacagctcgtcgccgaacatcaaatcccc
gcatcgcaatttgagtttcaaatgctatacggcatcaggccggagcgtcagaaggaactc
gccaaggaaggctacagaatgcgtgtgtatgtcccatatggaacggactggttcagctac
tttatgagaagaattgccgaacggcctgccaatgcagcgtttgtgttaaaaggaattttg
aaaaagtga

DBGET integrated database retrieval system