KEGG   Bacillus subtilis subsp. subtilis 168: BSU33650
Entry
BSU33650          CDS       T00010                                 

Symbol
yvzC
Name
(RefSeq) HTH-type transcriptional regulator YvzC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_3 HTH_26 HTH_31 LacI HTH_38 HTH_7 Phage_CP76 HTH_19 Trp_repressor HTH_5 HTH_Crp_2 HTH_35 CENP-B_N HTH_Tnp_1_2 HTH_AraC HTH_10 HTH_28 Xre-like-HTH
Other DBs
NCBI-GeneID: 936178
NCBI-ProteinID: NP_391245
Pasteur: BG14159
BSORF: BG14159
UniProt: O32235 A0A6M4JP92
Position
complement(3456282..3456515)
AA seq 77 aa
MPVEKIQIRRDYVLQYMVNNDYSLNQLALEIGVSPATLSRVLNGERRPGQLVIGKMLHYF
NLKFEDLFYYDFVDKSQ
NT seq 234 nt   +upstreamnt  +downstreamnt
gtgccagtagaaaagatacagattagacgtgattatgtcttgcagtatatggttaataac
gattattcccttaatcagcttgcgctggaaatcggagtctcacccgccacactgagccgc
gtgctgaatggagaaagaaggccggggcagcttgtgattggtaaaatgcttcactatttt
aatttgaaatttgaggatcttttttactatgatttcgttgacaaaagtcaataa

DBGET integrated database retrieval system