KEGG   Bacillus subtilis subsp. subtilis 168: BSU33730
Entry
BSU33730          CDS       T00010                                 

Symbol
opuBA
Name
(RefSeq) choline transport ATP-binding protein OpuBA
  KO
K05847  osmoprotectant transport system ATP-binding protein [EC:7.6.2.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU33730 (opuBA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33730 (opuBA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.9  ABC-type quaternary amine transporter
     BSU33730 (opuBA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    BSU33730 (opuBA)
SSDB
Motif
Pfam: ABC_tran CBS AAA_21 AAA_16 AAA_22 AAA Rad17 SMC_N AAA_15 AAA_30 RNA_helicase ATPase_2 AAA_24 Mg_chelatase AAA_28 ResIII G-alpha ATP-synt_ab AAA_18 RsgA_GTPase PRK tRNA_lig_kinase PduV-EutP DUF3987 TsaE AAA_29 AAA_23 AAA_19
Other DBs
NCBI-GeneID: 936230
NCBI-ProteinID: NP_391253
Pasteur: BG12633
BSORF: BG12633
UniProt: Q45460 A0A6M4JP91
Position
complement(3462105..3463250)
AA seq 381 aa
MLTLENVSKTYKGGKKAVNNVNLKIAKGEFICFIGPSGCGKTTTMKMINRLIEPSAGKIF
IDGENIMDQDPVELRRKIGYVIQQIGLFPHMTIQQNISLVPKLLKWPEQQRKERARELLK
LVDMGPEYVDRYPHELSGGQQQRIGVLRALAAEPPLILMDEPFGALDPITRDSLQEEFKK
LQKTLHKTIVFVTHDMDEAIKLADRIVILKAGEIVQVGTPDDILRNPADEFVEEFIGKER
LIQSSSPDVERVDQIMNTQPVTITADKTLSEAIQLMRQERVDSLLVVNDERVLQGYVDVE
IIDQCRKKANLVSEVLHEDIYTVLGGTLLRDTVRKILKRGVKYVPVVDEDRRLIGIVTRA
SLVDIVYDSLWGEEKQLAALS
NT seq 1146 nt   +upstreamnt  +downstreamnt
ttgctgacattagaaaatgtctcgaaaacatacaagggcggcaaaaaagccgtgaacaac
gtaaatcttaagattgcaaaaggcgaatttatctgctttatcgggccgagcggctgcgga
aaaacgacaacaatgaaaatgattaaccgattaattgagccttccgccgggaagattttc
attgacggcgaaaacatcatggaccaggatcctgtagagctcaggcgcaaaattggctat
gtgattcagcagatcggcctgtttccccatatgaccattcagcagaatatctcactcgtc
ccaaaactgctgaaatggccggagcagcagcggaaagagcgggcgcgtgagcttttaaaa
ttggtcgatatggggccagaatatgtagaccgttaccctcatgaattaagcggggggcag
cagcagcgaattggtgtattacgggcacttgccgcggagccgccgcttatcttaatggat
gaaccgtttggggcactcgacccgattacgagggattccctccaggaagaatttaaaaaa
ctgcaaaaaaccttacataaaaccatcgtatttgttacccacgatatggatgaagcgatt
aagctggcagaccggattgtgattttaaaagcgggagaaatcgttcaagttggaacgccc
gatgacattttaagaaatccggcagacgaatttgttgaggaatttatcggcaaggagcgg
ctgattcagtcatccagcccggatgttgaacgggttgaccagattatgaacacacagcct
gtaacgatcaccgcggataaaacgctttctgaggccattcagctgatgaggcaggaacgg
gtcgattcattgctggtcgtcaatgacgagcgcgttctgcaaggctatgtcgatgttgaa
atcattgatcaatgccggaaaaaggccaatctcgtcagtgaagttttacatgaagatata
tacacagtactgggcggcacactgctgcgcgacacggtccgcaaaattttaaaacggggt
gtcaaatatgttcccgttgtggatgaagaccgacgcctgatcggaattgtgacgagggca
agtctggtcgacatcgtgtatgactccctctggggagaagaaaagcagctcgcagcattg
tcatag

DBGET integrated database retrieval system