KEGG   Bacillus subtilis subsp. subtilis 168: BSU34110
Entry
BSU34110          CDS       T00010                                 

Symbol
rsbP
Name
(RefSeq) phosphoserine phosphatase RsbP
  KO
K07315  phosphoserine phosphatase RsbU/P [EC:3.1.3.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU34110 (rsbP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     BSU34110 (rsbP)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU34110 (rsbP)
SSDB
Motif
Pfam: SpoIIE PAS_9 PAS PAS_4
Other DBs
NCBI-GeneID: 936673
NCBI-ProteinID: NP_391291
Pasteur: BG12441
BSORF: BG12441
UniProt: O07014 A0A6M3ZJH2
Position
3500386..3501597
AA seq 403 aa
MDKQLNDAPCGFLALSEEGSIIAANRTLIKILDYEPEQVIGQHMNMMLTIPAQLFCQLYF
FPLLKLEHHIEEIYISLKARDGEEIPVLINAIARHDSGASVFDCVLIPMRKRNEYENELL
IARNEAQEALLAKQKANAELEIALETLKAKQEELLEINKQNQQFKLNTKRELELARKIQK
NSLTEPIVNDQVQIDSYYNASSELSGDLYGYYQIDEHRYGIIILDVMGHGISSALITMSL
HPLFQRQITQGLSPVKVMKELDRHLHSLFQNDEEARHYCTAIYLEIDIARQRIDYVNAGH
PPALWQDDSGTQHLLHATSPPIGMFEDLEFQSSSLSYTEDGRLLLYTDGVMDPTASCYLF
DLLKDHPDSPIADLKEKILTSLQHQKEAHHKSDDECFILVDVK
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggacaaacaattgaatgatgcaccatgcggtttcctcgctttgtcagaagaggggtcg
atcatagctgccaaccgcacccttatcaagattctggattatgaaccggagcaggttatc
ggccagcacatgaatatgatgttgaccattcccgcgcagcttttctgccagctttatttt
tttccgcttttgaaattggagcatcacatcgaagaaatatacatttccctgaaagcaaga
gatggagaagaaattcccgtccttatcaatgctattgcgagacacgatagcggggcttct
gtctttgattgtgttctgattccaatgcgaaagcgaaatgaatatgaaaatgagctgctg
atagccagaaatgaggctcaggaagctttgcttgccaaacagaaagccaatgcggagtta
gaaattgccttggaaacgctgaaagcaaaacaagaagaacttcttgagatcaataaacaa
aatcaacaatttaaattaaacaccaaaagagagcttgaactcgccagaaagatccagaaa
aactcgttgactgaaccgattgtaaacgatcaggttcagattgactcttattacaacgca
tcgagtgaattgtcaggtgatctttacggatattatcaaatcgatgaacaccgttacggc
attattatccttgatgtgatggggcacggaatttcatctgcattgattacgatgtctctt
catcctttgttccagcgccagatcacgcaaggtctcagccccgttaaagttatgaaggaa
ttggaccggcaccttcacagcttgtttcaaaatgatgaggaagcaagacattattgcact
gctatttatctcgagattgatatagcacggcaaagaattgattatgtcaacgcagggcat
ccgccggcactttggcaggacgatagcggaactcaacatctgcttcacgcgacctcgcct
ccgatcgggatgtttgaagacttagagtttcagtcaagcagcctttcatacacggaggac
ggaagattgcttctgtatacggatggcgtgatggatcctacggcttcatgttatttattt
gatttactaaaggatcatcctgattcgccaatcgctgacctgaaggagaaaatccttaca
tcactgcagcatcaaaaggaagctcatcataagagtgatgacgaatgttttatattagtt
gatgtaaaataa

DBGET integrated database retrieval system