KEGG   Bacillus subtilis subsp. subtilis 168: BSU34380Help
Entry
BSU34380          CDS       T00010                                 

Gene name
slrR
Definition
(RefSeq) HTH-type transcriptional regulator SlrR
  KO
K19417  HTH-type transcriptional regulator, biofilm formation regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU34380 (slrR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU34380 (slrR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 HTH_19 SinI HTH_26 HTH_25 HTH_23 HTH_7 HTH_AraC
Motif
Other DBs
NCBI-GeneID: 938581
NCBI-ProteinID: NP_391318
Pasteur: BG11858
BSORF: BG11858
UniProt: P71049
Position
3530101..3530559
Genome map
AA seq 152 aa AA seqDB search
MIGRIIRLYRKRKGYSINQLAVESGVSKSYLSKIERGVHTNPSVQFLKKVSATLEVELTE
LFDAETMMYEKISGGEEEWRVHLVQAVQAGMEKEELFTFTNRLKKEQPETASYRNRKLTE
SNIEEWKALMAEAREIGLSVHEVKSFLKTKGR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgattggaagaattatccgtttgtaccgtaaaagaaaaggctattctattaatcagctg
gctgttgagtcaggcgtatccaaatcctatttaagcaagattgaaagaggcgttcacacg
aatccgtccgttcaatttttaaaaaaagtttctgccacactggaagttgaattaacagaa
ttatttgacgcagaaacaatgatgtatgaaaaaatcagcggcggtgaagaagaatggcgc
gtacatttagtgcaagccgtacaagccgggatggaaaaggaagaattgttcacttttacg
aacagactcaagaaagaacagcctgaaactgcctcttaccgcaaccgcaaactgacggaa
tccaatatagaagaatggaaagcgctgatggcggaggcaagagaaatcggcttgtctgtc
catgaagtcaaatcctttttaaaaacaaagggaagatga

DBGET integrated database retrieval system