KEGG   Bacillus subtilis subsp. subtilis 168: BSU34640Help
Entry
BSU34640          CDS       T00010                                 

Gene name
yvdD
Definition
(RefSeq) LOG family protein YvdD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysine_decarbox LDcluster4 Phage_int_SAM_6
Motif
Other DBs
NCBI-GeneID: 936504
NCBI-ProteinID: NP_391344
Pasteur: BG12413
BSORF: BG12413
UniProt: O06986
Structure
PDB: 

Position
complement(3558940..3559515)
Genome map
AA seq 191 aa AA seqDB search
MKTICVFAGSNPGGNEAYKRKAAELGVYMAEQGIGLVYGGSRVGLMGTIADAIMENGGTA
IGVMPSGLFSGEVVHQNLTELIEVNGMHERKAKMSELADGFISMPGGFGTYEELFEVLCW
AQIGIHQKPIGLYNVNGYFEPMMKMVKYSIQEGFSNESHLKLIHSSSRPDELIEQMQNYS
YPILEKKWTEI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatttgtgtatttgcgggatcaaaccctgggggaaatgaagcgtataaaaga
aaagcggcagagcttggcgtgtatatggctgagcagggaatcggccttgtctatgggggc
tcccgcgtaggcttgatgggcacgattgctgacgcgattatggaaaacggcggaactgca
atcggggtcatgccgagcggtttgttcagcggggaggttgtccatcagaatctgactgag
ctgattgaagtaaacgggatgcatgaacgaaaggctaaaatgagcgagctggcggacggc
tttatctcgatgccgggcggcttcggtacatatgaagaattatttgaagtgctgtgctgg
gcacagatcggcatccaccaaaagccaattggactgtacaatgtaaacggatattttgaa
ccaatgatgaaaatggtgaaatacagcattcaagaagggttttctaacgaatcgcaccta
aaactgattcacagctcgtcacggccggatgagttaattgagcaaatgcaaaattattct
tatccgattttagaaaaaaagtggacagaaatttaa

DBGET integrated database retrieval system