KEGG   Bacillus subtilis subsp. subtilis 168: BSU34640
Entry
BSU34640          CDS       T00010                                 

Symbol
yvdD
Name
(RefSeq) LOG family protein YvdD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lysine_decarbox LDcluster4 Phage_int_SAM_6
Other DBs
NCBI-GeneID: 936504
NCBI-ProteinID: NP_391344
Pasteur: BG12413
BSORF: BG12413
UniProt: O06986 A0A6M4JPJ9
Structure
Position
complement(3558940..3559515)
AA seq 191 aa
MKTICVFAGSNPGGNEAYKRKAAELGVYMAEQGIGLVYGGSRVGLMGTIADAIMENGGTA
IGVMPSGLFSGEVVHQNLTELIEVNGMHERKAKMSELADGFISMPGGFGTYEELFEVLCW
AQIGIHQKPIGLYNVNGYFEPMMKMVKYSIQEGFSNESHLKLIHSSSRPDELIEQMQNYS
YPILEKKWTEI
NT seq 576 nt   +upstreamnt  +downstreamnt
atgaaaaccatttgtgtatttgcgggatcaaaccctgggggaaatgaagcgtataaaaga
aaagcggcagagcttggcgtgtatatggctgagcagggaatcggccttgtctatgggggc
tcccgcgtaggcttgatgggcacgattgctgacgcgattatggaaaacggcggaactgca
atcggggtcatgccgagcggtttgttcagcggggaggttgtccatcagaatctgactgag
ctgattgaagtaaacgggatgcatgaacgaaaggctaaaatgagcgagctggcggacggc
tttatctcgatgccgggcggcttcggtacatatgaagaattatttgaagtgctgtgctgg
gcacagatcggcatccaccaaaagccaattggactgtacaatgtaaacggatattttgaa
ccaatgatgaaaatggtgaaatacagcattcaagaagggttttctaacgaatcgcaccta
aaactgattcacagctcgtcacggccggatgagttaattgagcaaatgcaaaattattct
tatccgattttagaaaaaaagtggacagaaatttaa

DBGET integrated database retrieval system