KEGG   Bacillus subtilis subsp. subtilis 168: BSU34850
Entry
BSU34850          CDS       T00010                                 

Symbol
yvcA
Name
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2606 LPAM_1
Other DBs
NCBI-GeneID: 936576
NCBI-ProteinID: NP_391365
Pasteur: BG12393
BSORF: BG12393
UniProt: O06965 A0A6M4JPH4
Position
complement(3581965..3582690)
AA seq 241 aa
MKKIIFICFSLLLALTGGCSMNDNDKNSTNDNKTEAVKPKDMDPKDLPQVPAFQDEKTRE
YMVSTKEEEPGYYLLESKLKGFRMLFPEDGKYLSRRSSLTGKNKESIGFNSYDKDTNVMF
DGHVTYYKEESFANEPKTMLDIVSGKNDYKGEYKKSSKKKTDIYTAKKKDIFDDIDRKYN
YSYSYFGYVKSTEEDNLGVEYAFTLGCKNENQPCSLDEEKAKNKVEKLINSITFLIDKKE
K
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaaaaagatcatctttatttgcttcagcttattacttgccctgacaggaggatgcagt
atgaatgacaatgataaaaacagcacaaatgacaataaaacagaagcggtaaaaccaaaa
gacatggatcccaaggatctgcctcaagtacctgcgtttcaggacgagaaaacgagagag
tacatggtgtcaacaaaagaagaggaaccaggatattatttgctggaatctaagctgaaa
gggtttaggatgttgtttccggaggatggaaagtatctatcaagaagatcatcgttaacc
gggaaaaacaaagaaagtattggatttaatagttatgataaagacaccaatgtaatgttt
gatggccatgtaacatattacaaagaagaaagttttgcgaatgaacctaagacaatgcta
gatattgttagtggaaaaaatgattataaaggcgaatacaaaaaaagcagcaaaaagaaa
acggatatttacactgccaagaaaaaagacatctttgacgatattgatagaaaatataat
tattcatacagttattttggatatgttaagtctacagaggaagataacctaggagtagaa
tacgcctttacccttggatgcaaaaatgaaaatcaaccatgctccttagatgaagaaaag
gctaaaaataaagttgagaaattaattaattctatcacctttttaatagataaaaaggag
aaataa

DBGET integrated database retrieval system