KEGG   Bacillus subtilis subsp. subtilis 168: BSU34850Help
Entry
BSU34850          CDS       T00010                                 

Gene name
yvcA
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2606 SoDot-IcmSS
Motif
Other DBs
NCBI-GeneID: 936576
NCBI-ProteinID: NP_391365
Pasteur: BG12393
BSORF: BG12393
UniProt: O06965
Position
complement(3581965..3582690)
Genome map
AA seq 241 aa AA seqDB search
MKKIIFICFSLLLALTGGCSMNDNDKNSTNDNKTEAVKPKDMDPKDLPQVPAFQDEKTRE
YMVSTKEEEPGYYLLESKLKGFRMLFPEDGKYLSRRSSLTGKNKESIGFNSYDKDTNVMF
DGHVTYYKEESFANEPKTMLDIVSGKNDYKGEYKKSSKKKTDIYTAKKKDIFDDIDRKYN
YSYSYFGYVKSTEEDNLGVEYAFTLGCKNENQPCSLDEEKAKNKVEKLINSITFLIDKKE
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcatctttatttgcttcagcttattacttgccctgacaggaggatgcagt
atgaatgacaatgataaaaacagcacaaatgacaataaaacagaagcggtaaaaccaaaa
gacatggatcccaaggatctgcctcaagtacctgcgtttcaggacgagaaaacgagagag
tacatggtgtcaacaaaagaagaggaaccaggatattatttgctggaatctaagctgaaa
gggtttaggatgttgtttccggaggatggaaagtatctatcaagaagatcatcgttaacc
gggaaaaacaaagaaagtattggatttaatagttatgataaagacaccaatgtaatgttt
gatggccatgtaacatattacaaagaagaaagttttgcgaatgaacctaagacaatgcta
gatattgttagtggaaaaaatgattataaaggcgaatacaaaaaaagcagcaaaaagaaa
acggatatttacactgccaagaaaaaagacatctttgacgatattgatagaaaatataat
tattcatacagttattttggatatgttaagtctacagaggaagataacctaggagtagaa
tacgcctttacccttggatgcaaaaatgaaaatcaaccatgctccttagatgaagaaaag
gctaaaaataaagttgagaaattaattaattctatcacctttttaatagataaaaaggag
aaataa

DBGET integrated database retrieval system