KEGG   Bacillus subtilis subsp. subtilis 168: BSU34870Help
Entry
BSU34870          CDS       T00010                                 

Gene name
hisF
Definition
(RefSeq) imidazole glycerol phosphate synthase subunit HisF
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU34870 (hisF)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     BSU34870 (hisF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth NMO Dus ThiG TMP-TENI G3P_antiterm IMPDH
Motif
Other DBs
NCBI-GeneID: 936554
NCBI-ProteinID: NP_391367
Pasteur: BG12600
BSORF: BG12600
UniProt: O34727
Position
complement(3583562..3584320)
Genome map
AA seq 252 aa AA seqDB search
MITKRIIPCLDVKEGRVVKGIQFLELKDAGDPVELAEVYDREGADELVFLDISASHEGRK
TMVDVVEQVAAKLAIPFTVGGGINQLSDMKTILRAGADKVSVNTAAVLRPELITEGAEFF
GSQCIVLAIDAKYDKESDTYKVYTHGGRKKTDWEVTAWAKEGVKRGAGEILLTSMDSDGE
KKGFDHTLTKLVSEAVPVPVIASGGAGNAQHMLEAFTKGEADAALAASIFHYKETSIKEV
KSYLKEYGVNVR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcacaaaacggattatcccatgccttgatgtcaaagaaggacgcgttgtcaaagga
attcaatttctcgaattgaaggatgccggtgacccagttgaactcgccgaagtgtacgac
cgggaaggtgcggatgaacttgtttttcttgatatctccgcctcgcacgaaggacgaaag
acgatggttgacgttgtggagcaggttgccgcgaagcttgccattccgtttacagtcggc
ggcggcatcaatcagctcagcgatatgaaaacgatactgcgtgccggagcggacaaagtg
tcggtgaacacggcagctgttctccgccctgagctgattacagaaggagccgagtttttc
ggttctcaatgcatcgtacttgccattgatgccaagtatgacaaagaatctgacacatat
aaggtctacacgcacggcggcagaaagaaaacagattgggaggtcaccgcgtgggcaaaa
gaaggcgtcaaacgcggggcaggagaaatattgctgacaagcatggactccgacggtgag
aaaaaaggtttcgaccacacgctgacaaagcttgtttccgaagctgtccccgtccctgtt
atcgcttcgggaggcgcgggaaacgcacagcatatgcttgaggcttttacaaaaggagaa
gccgacgccgcgctggccgcctcaatttttcattataaagaaacatcgattaaagaagtg
aaatcatacttgaaagagtacggggtgaatgtgagatga

DBGET integrated database retrieval system