KEGG   Bacillus subtilis subsp. subtilis 168: BSU35010Help
Entry
BSU35010          CDS       T00010                                 

Gene name
nagA
Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU35010 (nagA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BSU35010 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 936621
NCBI-ProteinID: NP_391381
Pasteur: BG12630
BSORF: BG12630
UniProt: O34450
Structure
PDB: 

Position
3595356..3596546
Genome map
AA seq 396 aa AA seqDB search
MAESLLIKDIAIVTENEVIKNGYVGINDGKISTVSTERPKEPYSKEIQAPADSVLLPGMI
DIHIHGGYGADTMDASFSTLDIMSSRLPEEGTTSFLATTITQEHGNISQALVNAREWKAA
EESSLLGAELLGIHLEGPFVSPKRAGAQPKEWIRPSDVELFKKWQQEAGGLIKIVTLAPE
EDQHFELIRHLKDESIIASMGHTDADSALLSDAAKAGASHMTHLYNAMSPFHHREPGVIG
TALAHDGFVTELIADGIHSHPLAAKLAFLAKGSSKLILITDSMRAKGLKDGVYEFGGQSV
TVRGRTALLSDGTLAGSILKMNEGARHMREFTNCSWTDIANITSENAAKQLGIFDRKGSV
TVGKDADLVIVSSDCEVILTICRGNIAFISKEADQI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcagagagtcttcttatcaaagacattgcgatcgtgacagaaaatgaagtaatcaaa
aacggctatgtcggaatcaatgacggaaaaatcagcacagtttcaacagaacggcccaag
gagccatattcaaaagagattcaagcacctgcggattccgttttgcttcccggcatgatt
gacattcatatccacggcggctatggcgcagatacaatggatgctagcttttccacgctc
gacatcatgtcgtcaagactgcccgaagaaggcacgacgagctttttagccacaacgatt
acccaagagcatgggaacatttctcaagctttggtgaacgcaagagagtggaaagcggct
gaagagtcctctttattaggtgcagaactgctcggcattcatttagagggcccctttgtt
tcgcctaaaagagccggagcgcagccaaaggagtggattaggccttcggatgttgagctt
ttcaaaaagtggcagcaggaggcgggcggactgatcaaaattgttacacttgcgccggag
gaggatcagcattttgaactgatccgccatttgaaagacgaatcgattatcgcatccatg
gggcacacggatgccgattccgcattgctgtcggatgccgcaaaagcaggggcgagccat
atgactcatctgtacaacgcgatgagcccgtttcatcaccgagagcccggagtgatcgga
acggcgctggcccatgatgggtttgtgacagagcttatcgccgatggcattcactcccat
cctttagctgcaaagcttgcttttttggcgaaaggcagcagcaagctcattttaattacc
gattccatgagggcaaaaggactgaaagacggcgtatatgagttcggcggccaaagtgtg
acggtaagaggacgaacagcacttctttcagacggaacccttgccggttcgatcctcaaa
atgaacgaaggcgcacggcatatgcgtgagtttacaaattgctcttggacggatatagct
aatataacttctgaaaacgcggccaaacagctgggcatctttgaccgaaaaggcagtgtg
actgtgggaaaagatgcagatttggtgattgtcagcagtgattgcgaggtgattctcacc
atttgccgcggaaacattgcatttatatccaaggaggctgaccagatatga

DBGET integrated database retrieval system