KEGG   Bacillus subtilis subsp. subtilis 168: BSU35110Help
Entry
BSU35110          CDS       T00010                                 

Gene name
yvlC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PspC
Motif
Other DBs
NCBI-GeneID: 936642
NCBI-ProteinID: NP_391391
Pasteur: BG14118
BSORF: BG14118
UniProt: O34719
Position
complement(3607123..3607320)
Genome map
AA seq 65 aa AA seqDB search
MNKLYRSEKNKKIAGVIGGLAEYFNWDASLLRVITVILAIMTSVLPVLLIYIIWIFIVPS
ERDMK
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgaataagctttatcgctcagaaaaaaataagaaaatcgccggtgttatcggaggtctc
gcggaatatttcaattgggacgcatcactcctcagagtcataactgtcatcttagccatt
atgacaagtgtcttgccggttttgctcatttatatcatttggatttttatcgtcccgtca
gaaagggatatgaaatga

DBGET integrated database retrieval system