KEGG   Bacillus subtilis subsp. subtilis 168: BSU35110
Entry
BSU35110          CDS       T00010                                 

Symbol
yvlC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PspC
Other DBs
NCBI-GeneID: 936642
NCBI-ProteinID: NP_391391
Pasteur: BG14118
BSORF: BG14118
UniProt: O34719 A0A6M3ZHG4
Position
complement(3607123..3607320)
AA seq 65 aa
MNKLYRSEKNKKIAGVIGGLAEYFNWDASLLRVITVILAIMTSVLPVLLIYIIWIFIVPS
ERDMK
NT seq 198 nt   +upstreamnt  +downstreamnt
atgaataagctttatcgctcagaaaaaaataagaaaatcgccggtgttatcggaggtctc
gcggaatatttcaattgggacgcatcactcctcagagtcataactgtcatcttagccatt
atgacaagtgtcttgccggttttgctcatttatatcatttggatttttatcgtcccgtca
gaaagggatatgaaatga

DBGET integrated database retrieval system