KEGG   Bacillus subtilis subsp. subtilis 168: BSU35240Help
Entry
BSU35240          CDS       T00010                                 

Gene name
ctpB
Definition
(RefSeq) carboxy-terminal processing protease CtpB
  KO
K03797  carboxyl-terminal processing protease [EC:3.4.21.102]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU35240 (ctpB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.102  C-terminal processing peptidase
     BSU35240 (ctpB)
Peptidases [BR:bsu01002]
 Serine Peptidases
  Family S41: C-terminal processing peptidase family
   BSU35240 (ctpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S41 PDZ_2 PG_binding_1 PDZ_6 PDZ DUF3394 DUF126
Motif
Other DBs
NCBI-GeneID: 936678
NCBI-ProteinID: NP_391404
Pasteur: BG14110
BSORF: BG14110
UniProt: O35002
Structure
PDB: 

Position
complement(3622356..3623798)
Genome map
AA seq 480 aa AA seqDB search
MNQKIMAVIAAGSMLFGGAGVYAGINLLEMDKPQTAAVPATAQADSERDKAMDKIEKAYE
LISNEYVEKVDREKLLEGAIQGMLSTLNDPYSVYMDKQTAKQFSDSLDSSFEGIGAEVGM
EDGKIIIVSPFKKSPAEKAGLKPNDEIISINGESMAGKDLNHAVLKIRGKKGSSVSMKIQ
RPGTKKQLSFRIKRAEIPLETVFASEKKVQGHSVGYIAISTFSEHTAEDFAKALRELEKK
EIEGLVIDVRGNPGGYLQSVEEILKHFVTKDQPYIQIAERNGDKKRYFSTLTHKKAYPVN
VITDKGSASASEILAGALKEAGHYDVVGDTSFGKGTVQQAVPMGDGSNIKLTLYKWLTPN
GNWIHKKGIEPTIAIKQPDYFSAGPLQLKEPLKVDMNNEDVKHAQVLLKGLSFDPGREDG
YFSKDMKKAVMAFQDQNKLNKTGVIDTRTAETLNQQIEKKKSDEKNDLQLQTALKSLFVN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaaataatggctgtgatagcagcagggagcatgctgttcggaggcgccggt
gtatatgcgggaatcaacctgcttgagatggataagccccagactgcagcagttcccgcg
acggcacaagctgactctgaacgggataaagctatggacaaaatcgaaaaagcgtatgag
ttaatttcgaatgagtacgtagaaaaagtagatagagaaaagctgctcgagggagccatc
cagggaatgctgtctacgctaaatgatccttattctgtttacatggacaagcagacagct
aagcaattttctgattctcttgattcctcatttgaaggcatcggggctgaggttggaatg
gaagacggcaaaattattattgtttctccattcaagaaatcgccagcggaaaaagccggg
ttgaagcctaatgatgaaattatcagcatcaatggagaatcgatggccggcaaggattta
aaccacgctgtgttaaaaataagaggaaaaaaagggtccagcgtttcaatgaagattcag
cggcctggaacgaagaagcagttgtcattccggatcaagagagctgagattccgctcgaa
acggtttttgcatcagagaaaaaagtacaggggcattctgtcggatatattgccatctct
actttttctgagcacaccgcagaggattttgcaaaagcgctgagggagcttgagaaaaaa
gaaatagaaggacttgtcattgatgtacgcggcaacccgggtggatatcttcaaagtgtg
gaagaaattcttaagcatttcgttacaaaggatcagccgtatattcagattgctgaacgc
aatggagataaaaaacgttatttttcaacattgacccataaaaaagcgtaccctgtcaat
gtgattacggataaaggaagtgcctctgcatcagaaattcttgccggcgcattaaaggaa
gctggccattatgatgttgtaggcgatacgtcttttggaaagggaacggttcaacaggct
gtgccaatgggggacggcagcaacatcaaattaacgctttacaagtggctgacgccaaat
ggaaactggattcataagaaaggaattgaaccgaccattgcgattaagcagcccgattat
ttttccgccgggcccttacagctgaaagagccgcttaaagtggacatgaacaatgaagac
gtcaagcatgcgcaggtattgttaaaaggtctcagctttgatccgggacgtgaggatggc
tatttcagcaaagacatgaaaaaagcggttatggcttttcaggatcaaaacaagctgaat
aaaaccggtgtgatcgacactcgcactgcagagacattaaatcagcagatagaaaagaaa
aaatcagatgaaaaaaatgatttgcagcttcaaacagcattgaaatcattatttgtcaat
taa

DBGET integrated database retrieval system